@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3774: (2016-02-20 )
MTRRTAFFFDELCLWHAAGPHALTLPVGGWVQPPAAAGHAESPETKRRLKSLLDVSGLTARLQLRSAPPASDEDLLRVHPAHYLERFKALSDAGGGSLGQDAPIGPGSYEIARLSAGLAIAALDAVLAGEADNAYSLSRPPGHHCLPDQAMGFCFFANIAVAIEAAKARHGVERVAVLDWDVHHGNGTQAIYYRRDDVLSISLHQDGCFPPGYSGAEDIGEDRGRGFNLNVPLLPGGGHDAYMQAMQRIVLPALERFRPQLIVVASGFDANAVDPLARMQLHSDSFRAMTAMVRDAAERHAGGRLVVVHEGGYSEAYVPFCGLAVIEELSGVRSAVRDPLRDFIELQQPNAAFRDFQRQRLEELAAQFGLCPAQPLQAAR

Atome Classification :

(52 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

6XA_B_12(4ZUQ)
?
[Raw transfer]




5XA_A_7(4ZUP)
?
[Raw transfer]




5XA_B_16(4ZUP)
?
[Raw transfer]




6XA_A_5(4ZUQ)
?
[Raw transfer]




XS6_A_6(4ZUO)
?
[Raw transfer]




9F4_B_7(4CBT)
HDAC4_HUMAN
[Raw transfer]




XS6_B_12(4ZUO)
?
[Raw transfer]




9F4_A_4(4CBT)
HDAC4_HUMAN
[Raw transfer]




9F4_C_10(4CBT)

[Raw transfer]




TSN_B_17(3C10)
HDAC7_HUMAN
[Raw transfer]




SHH_C_18(3C0Z)

[Raw transfer]




TSN_C_18(3C10)

[Raw transfer]




HA3_A_6(2VQV)
HDAC4_HUMAN
[Raw transfer]




TFG_B_12(2VQQ)

[Raw transfer]




TFG_B_12(2VQO)

[Raw transfer]




FKS_B_13(4ZUM)
?
[Raw transfer]




FKS_A_6(4ZUM)
?
[Raw transfer]




SHH_B_17(3C0Z)
HDAC7_HUMAN
[Raw transfer]




TFG_A_7(2VQQ)
HDAC4_HUMAN
[Raw transfer]




TFG_A_8(2VQJ)

[Raw transfer]




TSN_A_16(3C10)
HDAC7_HUMAN
[Raw transfer]




SHH_A_16(3C0Z)
HDAC7_HUMAN
[Raw transfer]




TFG_A_7(2VQO)
HDAC4_HUMAN
[Raw transfer]




HA3_A_4(2VQM)

[Raw transfer]




HA3_A_4(2VQM)

[Raw transfer]




HA3_B_13(2VQV)

[Raw transfer]




NU9_A_8(3ZNR)
HDAC7_HUMAN
[Raw transfer]




NU7_A_8(3ZNS)
HDAC7_HUMAN
[Raw transfer]




NU7_B_13(3ZNS)
HDAC7_HUMAN
[Raw transfer]




NU7_C_18(3ZNS)

[Raw transfer]




SS9_B_13(4ZUN)
?
[Raw transfer]




SS9_A_3(4ZUN)
?
[Raw transfer]




115 HHSearch 98.4645%-100 - C6 -1ZZ1 - HDAH_ALCSD -
26 PsiBlast_CBE 96.9249% -98 - C6 -2GH6 - HDAH_ALCSD -
35 PsiBlast_CBE 96.9049% -99 - C6 -1ZZ0 - HDAH_ALCSD -
33 PsiBlast_CBE 96.8649% -99 - C6 -1ZZ0 - HDAH_ALCSD -
31 PsiBlast_CBE 96.6349% -99 - C6 -1ZZ1 - HDAH_ALCSD -
2 PsiBlast_PDB 96.6349% -99 - C6 -1ZZ1 - HDAH_ALCSD -
1 PsiBlast_PDB 96.5149% -98 - C6 -1ZZ0 - HDAH_ALCSD -
34 PsiBlast_CBE 96.4549%-101 - C6 -1ZZ0 - HDAH_ALCSD -
25 PsiBlast_CBE 96.4449% -99 - C6 -2GH6 - HDAH_ALCSD -
23 PsiBlast_CBE 96.3949%-102 - C6 -2VCG - HDAH_ALCSD -
29 PsiBlast_CBE 96.3049%-100 - C6 -1ZZ3 - HDAH_ALCSD -
24 PsiBlast_CBE 96.1849% -98 - C6 -2GH6 - HDAH_ALCSD -
21 PsiBlast_CBE 96.1349%-102 - C6 -2VCG - HDAH_ALCSD -
32 PsiBlast_CBE 96.1249%-100 - C6 -1ZZ1 - HDAH_ALCSD -
5 PsiBlast_PDB 96.1149%-100 - C6 -2VCG - HDAH_ALCSD -
125 Fugue 96.0344% -94 - C6 -1ZZ1 - HDAH_ALCSD -
22 PsiBlast_CBE 96.0049%-100 - C6 -2VCG - HDAH_ALCSD -
27 PsiBlast_CBE 95.9049% -99 - C6 -1ZZ3 - HDAH_ALCSD -
4 PsiBlast_PDB 95.8049% -98 - C6 -2GH6 - HDAH_ALCSD -
30 PsiBlast_CBE 95.5549% -98 - C6 -1ZZ1 - HDAH_ALCSD -
116 HHSearch 86.6031% -90 - C6 -2VQM 3.3
45 PsiBlast_CBE 80.4731% -91 - C6 -3ZNS 7.7 HDAC7_HUMAN
17 PsiBlast_PDB 80.4731% -97 - C6 -3ZNR 8.0 HDAC7_HUMAN
16 PsiBlast_PDB 80.4731% -93 - C6 -3C10 4.8 HDAC7_HUMAN
44 PsiBlast_CBE 80.1931% -98 - C6 -3ZNS 7.9
15 PsiBlast_PDB 79.5731% -92 - C6 -3C0Z 3.8 HDAC7_HUMAN
18 PsiBlast_PDB 79.3931% -96 - C6 -3ZNS 8.4 HDAC7_HUMAN
50 PsiBlast_CBE 79.0231% -97 - C6 -3C0Z 3.5
48 PsiBlast_CBE 78.9831% -99 - C6 -3C10 4.6
51 PsiBlast_CBE 78.5031% -98 - C6 -3C0Z 3.7 HDAC7_HUMAN
49 PsiBlast_CBE 78.1631% -96 - C6 -3C10 4.8 HDAC7_HUMAN
6 PsiBlast_PDB 77.3935%-105 - C6 -2VQO 5.0 HDAC4_HUMAN
38 PsiBlast_CBE 77.3234%-108 - C6 -2VQQ 5.1
43 PsiBlast_CBE 77.3034%-109 - C6 -4CBT 5.7 HDAC4_HUMAN
37 PsiBlast_CBE 77.1335%-106 - C6 -2VQO 5.1
13 PsiBlast_PDB 76.6134%-110 - C6 -4CBT 5.8 HDAC4_HUMAN
9 PsiBlast_PDB 76.5834%-105 - C6 -2VQQ 4.2 HDAC4_HUMAN
12 PsiBlast_PDB 76.4334%-107 - C6 -2VQM 3.7
11 PsiBlast_PDB 76.2134%-106 - C6 -2VQJ 4.6
7 PsiBlast_PDB 76.1135%-103 - C6 -2VQV 3.6 HDAC4_HUMAN
42 PsiBlast_CBE 75.8534%-105 - C6 -4CBT 5.9
36 PsiBlast_CBE 75.7335%-104 - C6 -2VQV 3.6
59 PsiBlast_CBE 73.6737%-102 - C6 -4ZUO 3.8 ?
61 PsiBlast_CBE 73.4637%-106 - C6 -4ZUN 2.7 ?
62 PsiBlast_CBE 73.4437%-103 - C6 -4ZUN 2.7 ?
58 PsiBlast_CBE 73.4037%-101 - C6 -4ZUP 2.7 ?
64 PsiBlast_CBE 73.3237%-104 - C6 -4ZUM 3.4 ?
55 PsiBlast_CBE 73.2937%-104 - C6 -4ZUQ 3.1 ?
60 PsiBlast_CBE 73.1737%-103 - C6 -4ZUO 3.8 ?
63 PsiBlast_CBE 72.8637%-103 - C6 -4ZUM 3.7 ?
56 PsiBlast_CBE 72.8537%-102 - C6 -4ZUQ 3.1 ?
57 PsiBlast_CBE 72.7437%-102 - C6 -4ZUP 2.8 ?