@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0739: (2016-03-18 )
MFNLQKGFPENFKWGSSTNAQQFEGGYKEGGKGLSIADVRVIPDMPDESDFESFKTASDHYHHYKEDIAYYGEMGFQIYRFTMAWSRIFPNGDETEPNDAGVEFYSNMLAELEKYNIEPVVTLYAYDMPLQLLEKYNGWLDRAIIKDYLHYVETVVKLFKGRVKYWVPFNEQNFISIDSEYMSGYRAKNKAEVFQIQHHFNLCYAEATKLVHQIDPDAKVGGNIGNICPYPMTCKPEDVEASDKVAQQLGYAYGDIYFRGYYPKYFLKEYEGVDFEQIILDDDLTIIKSSEPDFMSLTYYMSSAIEAKGEEEVVVMNGIKAPNPYCETTEWGWTIDPYGFKHYLQEFYHRYQLPILILENGMGARDEKNTDDTIDDTYRIDYLASHIARMQEAVEEGCEIIGYLTWSATDLYSTREGFEKRYGFVYVDKDNSYKRLKKKSFYWYKKVIETNGNDLNY

Atome Classification :

(20 SA) .........10........20........30.......-.---------40--..--------..--.-.----.--.50...-------.....60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170---..-----------...-----...180..-----.-..---..---------190.......200.......210....-...220.......-230.......240.......250.......260.......270.......280.......290.......300---......-.-----310-----.......-320-........330.......340.......350........360.......370----.......380.......390..-.-....400.......410.....-..420.......430---.----.......440.......450.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MFNLQKGFPENFKWGSSTNAQQFEGGYKEGGKGLSIAD-V---------RV--IP--------DM--P-D----E--SDFESF-------KTASDHYHHYKEDIAYYGEMGFQIYRFTMAWSRIFPNGDETEPNDAGVEFYSNMLAELEKYNIEPVVTLYAYDMPLQLLEKYNGWLDRAIIKDYLHYVETVVKLFKGRVKYWVPFNE----QN-----------FIS-----IDSEYMSG-----Y-RA---KN---------KAEVFQIQHHFNLCYAEATKLVHQIDP-DAKVGGNIGNICP-YPMTCKPEDVEASDKVAQQLGYAYGDIYFRGYYPKYFLKEYEGVDFEQIILDDDLTIIKSSEPDFMSLTYYMS---SAIEAK-G-----EEE-----VVVMNGI-KA--PNPYCETTEWGWTIDPYGFKHYLQEFYHRY-QLPILILENGMGARDEKNTDD----TIDDTYRIDYLASHIARMQEAV-E-EGCEIIGYLTWSATDLYSTREG-FEKRYGFVYVDKDN----S----YKRLKKKSFYWYKKVIETNGNDLNY
21 PsiBlast_CBE 93.2839% -73 - C1 -2XHY BGLA_ECOLI D:[8-479] -------LPKDFLWGGAVAAHQVEGGWNKGGKGPSICD-V---------LTGGAH--------GV--P-R----E--ITKEVLPGKYYPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE----IN-----------NQR-----NWRAPLFG-----Y-CC---SGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINP-EMKVGCMLAMVPL-YPYSCNPDDVMFAQESMRER-YVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLDVLREGTCDYLGFSYYMT---NAVKAE-G-----------------------SVPNPYVKASDWGWQIDPVGLRYALCELYERY-QRPLFIVENGFGAYDKVEEDG----SINDDYRIDYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGD----MSRSRKKSFNWYKEVIASNGEKL--
94 HHSearch 93.1941% -69 - C1 -2XHY BGLA_ECOLI A:[4-479] ---KKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICD-V---------LT--GG--------AHGVPREITKEVLPGKYYPN-------HEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE----IN-----------NQRNWRAPLFG-YCCS-----GVVY---TEHENP-----EETMYQVLHHQFVASALAVKAARRINP-EMKVGCMLAMVPL-YPYSCNPDDVMFAQESMRE-RYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLDVLREGTCDYLGFSYYMT---NAVKAE-G-----GT-----------FEGSV--PNPYVKASDWGWQIDPVGLRYALCELYERY-QRPLFIVENGFGAYDKVEEDG----SINDDYRIDYLRAHIEEMKKAVTY-DGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHD----DGTGDMSRSRKKSFNWYKEVIASNGEKL--
3 PsiBlast_PDB 92.8939% -75 - C1 -4IPN ? B:[20-485] -------FPDDFLWGGAVAANQVEGAYNEDGKGLSVQD-V-------------LPKGGLGEATEN--P-T----E--DNLKLI---------GIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKYYDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWVDRRMIHFYEKFARTVLERYKDKVKYWLTFNE----VN-----------SV------LELPFTSGGIDIPK-EN---LS---------KQELYQAIHHELVASSLVTKIAREINS-EFKVGCMVLAMPA-YPMTPNPKDVWATHEY-ENLNYLFSDVHVRGYYPNYAKRYFKENDINIEFAAEDAELLKNYTVDFLSFSYYMSVTQSALP----------------------GL-V----NPYLESSEWGWQIDPIGLRIILNRYYDRY-QIPLFIVENGLGAKDQLIKDELNNLTVQDDYRIQYMKEHLLQVAEAL-Q-DGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGSGT----LNRYKKMSFTWYKEVIESNGESL--
22 PsiBlast_CBE 92.6039% -73 - C1 -2XHY BGLA_ECOLI C:[8-479] -------LPKDFLWGGAVAAHQVEGGWNKGGKGPSICD-V---------LTGGAH--------GV--P-R----E--ITKEVLPGKYYPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE----IN-----------NQR-----NWRAPLFG-----Y-CC---SGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINP-EMKVGCMLAMVPL-YPYSCNPDDVMFAQESMRER-YVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLDVLREGTCDYLGFSYYMT---NAVKAE-G-----G----------------GSVPNPYVKASDWGWQIDPVGLRYALCELYERY-QRPLFIVENGFGAYDKVEEDG----SINDDYRIDYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGD----MSRSRKKSFNWYKEVIASNGEKL--
8 PsiBlast_PDB 92.0738% -75 - C1 -3QOM ? A:[9-480] -----RAFPEGFLWGGAVAAHQLEGGYKEGGKGLSTAD-IMTLGTNERPRE--IT--------DG--V-V----A--GKYYPN-------HQAIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNGDESEPNEAGLQFYDDLFDECLKNGIQPVVTLAHFEMPYHLVKQYGGWRNRKLIQFYLNFAKVCFERYRDKVTYWMTFNEINNQTN-----------FESDGAMLTDSGIIHQ-----P-GE---NR---------ERWMYQAAHYELVASAAAVQLGHQINP-DFQIGCMIAMCPI-YPLTAAPADVLFAQR-AMQTRFYFADVHCNGTYPQWLRNRFESEHFNLDITAEDLKILQAGTVDYIGFSYYMS---FTVKDT-GKLAYNEEH-----DLVK---------NPYVKASDWGWQVDPVGLRYAMNWFTDRY-HLPLFIVENGLGAIDKKTADN----QIHDDYRIDYLTDHLRQIKLAVLE-DGVDLIGYTPWGCIDLVAASTGQMSKRYGFIYVDENDDGSGS----LKRYKKDSFTWFQHVIATNGAEI--
9 PsiBlast_PDB 91.7138% -75 - C1 -4GZE ? A:[9-480] -----RAFPEGFLWGGAVAAHQLEGGYKEGGKGLSTAD-IMTLGTNERPRE--IT--------DG--V-V----A--GKYYPN-------HQAIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNGDESEPNEAGLQFYDDLFDECLKNGIQPVVTLAHFEMPYHLVKQYGGWRNRKLIQFYLNFAKVCFERYRDKVTYWMTFNEINNQTN-----------FESDGAMLTDSGIIHQ-----P-GE---NR---------ERWMYQAAHYELVASAAAVQLGHQINP-DFQIGCMIAMCPI-YPLTAAPADVLFAQR-AMQTRFYFADVHCNGTYPQWLRNRFESEHFNLDITAEDLKILQAGTVDYIGFSYYMS---FTVKDT-GKLAYNEEH-----DLVK---------NPYVKASDWGWQVDPVGLRYAMNWFTDRY-HLPLFIVENGLGAIDKKTADN----QIHDDYRIDYLTDHLRQIKLAVLE-DGVDLIGYTPWGCIDLVAASTGQMSKRYGFIYVDENDDGSGS----LKRYKKDSFTWFQHVIATNGAEI--
2 PsiBlast_PDB 91.3639% -75 - C1 -4IPL ? A:[20-485] -------FPDDFLWGGAVAANQVEGAYNEDGKGLSVQD-V-------------LPKGGLGEATEN--P-T----E--DNLKLI---------GIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKYYDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWVDRRMIHFYEKFARTVLERYKDKVKYWLTFNE----VN-----------SV------LELPFTSGGIDIPK-EN---LS---------KQELYQAIHHELVASSLVTKIAREINS-EFKVGCMVLAMPA-YPMTPNPKDVWATHEY-ENLNYLFSDVHVRGYYPNYAKRYFKENDINIEFAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQY-------------------GL-V----NPYLESSEWGWQIDPIGLRIILNRYYDRY-QIPLFIVENGLGAKDQLIKDELNNLTVQDDYRIQYMKEHLLQVAEAL-Q-DGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGSGT----LNRYKKMSFTWYKEVIESNGESL--
1 PsiBlast_PDB 90.7639% -72 - C1 -2XHY BGLA_ECOLI A:[8-479] -------LPKDFLWGGAVAAHQVEGGWNKGGKGPSICD-V---------LTGGAH--------GV--P-R----E--ITKEVLPGKYYPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE----IN-----------NQR-----NWRAPLFG-----Y-CC---SGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINP-EMKVGCMLAMVPL-YPYSCNPDDVMFAQESMRER-YVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLDVLREGTCDYLGFSYYMT---NAVKAE-G-----GT------------F-EGSVPNPYVKASDWGWQIDPVGLRYALCELYERY-QRPLFIVENGFGAYDKVEEDG----SINDDYRIDYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGD----MSRSRKKSFNWYKEVIASNGEKL--
13 PsiBlast_PDB 89.9330% -75 - C1 -4HZ8 ? A:[4-441] ------KFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRF---------TR--IP--------GK--I-K----N--GD--SG-------DVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSR-QINQRGLDFYRRLVEGLHKRDILPMATLYHWDLP-QWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNE----P------------MVT-----VWAGYHMG-----L-FAPGLKD---------PTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTI-YPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYP--NLPEFIAPEDMQTI-SAPIDFLGVNYYNP---MRVKSS-P-----QPP-----GIEVVQV-ES--P-----VTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSG----QVNDPQRVGYFQGHIGAARRAL-A-DGVDLRGYYAWSLLDNFEWAEG-YSKRFGIIYVDFET----Q----QRTL-KQSAQWYRDVIANNG-----
14 PsiBlast_PDB 89.8930% -76 - C1 -3CMJ ? A:[24-462] -----KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRF---------TR--IP--------GK--I-K----N--GD--SG-------DVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSR-QINQRGLDFYRRLVEGLHKRDILPMATLYHWDLP-QWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNE----P------------MVT-----VWAGYHMG-----L-FAPGLKD---------PTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTI-YPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYP--NLPEFIAPEDMQTI-SAPIDFLGVNYYNP---MRVKSS-P-----QPP-----GIEVVQV-ES--P-----VTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSG----QVNDPQRVGYFQGHIGAARRAL-A-DGVDLRGYYAWSLLDNFEWAEG-YSKRFGIIYVDFET----Q----QRTL-KQSAQWYRDVIANNG-----
23 PsiBlast_CBE 89.5439% -71 - C1 -2XHY BGLA_ECOLI B:[8-479] -------LPKDFLWGGAVAAHQVEGGWNKGGKGPSICD-V---------LTGGAH--------GV--P-R----E--ITKEVLPGKYYPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE----IN-----------NQR-----NWRAPLFG-----Y-CC---SGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINP-EMKVGCMLAMVPL-YPYSCNPDDVMFAQESMRER-YVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLDVLREGTCDYLGFSYYMT---NAVKAE-G-----G---------------EGSVPNPYVKASDWGWQIDPVGLRYALCELYERY-QRPLFIVENGFGAYDKVEEDG----SINDDYRIDYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGD----MSRSRKKSFNWYKEVIASNGEKL--
12 PsiBlast_PDB 89.0330% -78 - C1 -4HZ7 ? A:[3-441] -----KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRF---------TR--IP--------GK--I-K----N--GD--SG-------DVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSR-QINQRGLDFYRRLVEGLHKRDILPMATLYHWDLP-QWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNE----P------------MVT-----VWAGYHMG-----L-FAPGLKD---------PTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTI-YPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYP--NLPEFIAPEDMQTI-SAPIDFLGVNYYNP---MRVKSS-P-----QPP-----GIEVVQV-ES--P-----VTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSG----QVNDPQRVGYFQGHIGAARRAL-A-DGVDLRGYYAWSLLDNFEWAEG-YSKRFGIIYVDFET----Q----QRTL-KQSAQWYRDVIANNG-----
24 PsiBlast_CBE 88.6239% -72 - C1 -4IPN ? E:[20-485] -------FPDDFLWGGAVAANQVEGAYNEDGKGLSVQD-V-------------LPKGGLGEATEN--P-T----E--DNLKLI---------GIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKYYDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWVDRRMIHFYEKFARTVLERYKDKVKYWLTFNE----VN-----------SV------LELPFTSGGIDIPK-EN---LS---------KQELYQAIHHELVASSLVTKIAREINS-EFKVGCMVLAMPA-YPMTPNPKDVWATHEY-ENLNYLFSDVHVRGYYPNYAKRYFKENDINIEFAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYN-----S-----------GGL-V----NPYLESSEWGWQIDPIGLRIILNRYYDRY-QIPLFIVENGLGAKDQLIKDELNNLTVQDDYRIQYMKEHLLQVAEAL-Q-DGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGSGT----LNRYKKMSFTWYKEVIESNGESL--
11 PsiBlast_PDB 88.5230% -75 - C1 -4HZ6 ? A:[3-441] -----KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRF---------TR--IP--------GK--I-K----N--GD--SG-------DVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSR-QINQRGLDFYRRLVEGLHKRDILPMATLYHWDLP-QWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNE----P------------MVT-----VWAGYHMG-----L-FAPGLKD---------PTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTI-YPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYP--NLPEFIAPEDMQTI-SAPIDFLGVNYYNP---MRVKSS-P-----QPP-----GIEVVQV-ES--P-----VTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSG----QVNDPQRVGYFQGHIGAARRAL-A-DGVDLRGYYAWSLLDNFEWAEG-YSKRFGIIYVDFET----Q----QRTL-KQSAQWYRDVIANNG-----
5 PsiBlast_PDB 88.3338% -70 - C1 -4F79 ? A:[3-480] ---AMSKLPENFLWGGAVAAHQLEGGWQEGGKGISVAD-VMTAGRHGVARE--IT--------AG--V-L----E--GKYYPN-------HEAIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDEAEPNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEYGGFTNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNE----INNQANYQEDFAPFTN-----SGIVYKEG--------D---DR---------EAIMYQAAHYELVASARAVKIGHAINP-NLNIGCMVA-MCPIYPATCNPKDILMAQK-AMQKRYYFADVHVHGFYPEHIFKYWERKAIKVDFTERDKKDLFEGTVDYIGFSYYMS---FVIDAH-R-----ENNPYYDYLETEDLV-K----NPYVKASDWDWQIDPQGLRYALNWFTDMY-HLPLFIVQNGFGAIDQVEADG----MVHDDYRIDYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDEGKGT----LKRSPKLSFNWYKEVIASNGDDI--