@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu21820: (2016-07-03 )
MTQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVMSKQMRFDNSEVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNKMGVHIWDQWKQEDGTIGHAYGFQLGKKNRSLNGEKVDQVDYLLHQLKNNPSSRRHITMLWNPDDLDAMSLTPCVYETQWYVKHGKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEVKDFYNFTIDDFKLINYKHGDKLLFEVAV

Atome Classification :

(61 SA) .........10........20..--------......30........40....-....50-.-..--.-.....60........70........80........90......------------...------------100------------------------------------------------.........110--.....------...-------120-------------------------------.........130.......140.......150.......160.......170-----........180.......190.......200.......210.......220.......230.......240.......250----------....---....260.......270.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVMS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNKMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL-------N---------------------------------GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDDLDAMSLTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---NFTIDDFKLINYKHGDKLLFEVAV
3 PsiBlast_PDB 99.4898% -92 - C- -1BKP - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL-------N---------------------------------GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
2 PsiBlast_PDB 98.9298% -89 - C8 -1BKO - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL-------N---------------------------------GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
21 PsiBlast_CBE 98.4798% -90 - C8 -1BSP TYSY1_BACSU B:[1-278] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL-------N---------------------------------GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
1 PsiBlast_PDB 98.3098% -86 - C8 -1B02 TYSY1_BACSU A:[1-279] MTQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL-------N---------------------------------GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
5 PsiBlast_PDB 96.9098% -89 - C8 -1BSP TYSY1_BACSU A:[1-278] -TQFDKQYNSIIKDIINNGISD---------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL-------N---------------------------------GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
4 PsiBlast_PDB 96.7398% -87 - C8 -1BSF - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL-------N---------------------------------GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
101 HHSearch 78.3096% 13 - C- -1BKP - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGT-PA-----H--TLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL-------N---------------------------------GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
122 Fugue 76.3498% 1 - C- -1BKP - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS---EVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMM-GVHIWDQWKQE--------------------------------------------------------------------------DGTIGHAYGFQ---LGKK-NRSLNG---------------------------------------------EKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------K---DFYDFTIDDFKLINYKHGDKLLFEVAV
88 PsiBlast_CBE 67.9136% 5 - C8 -4H1I TYSY_HUMAN A:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
59 PsiBlast_CBE 67.6136% 4 - C8 -3HB8 TYSY_HUMAN A:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
54 PsiBlast_CBE 67.6036% 5 - C8 -3OB7 TYSY_HUMAN A:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
57 PsiBlast_CBE 67.5936% 6 - C8 -3HB8 TYSY_HUMAN C:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
53 PsiBlast_CBE 67.5336% 6 - C8 -3OB7 TYSY_HUMAN B:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
43 PsiBlast_CBE 67.4736% 3 - C8 -3EJL TYSY_HUMAN B:[32-308] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIK-----
58 PsiBlast_CBE 67.3736% 6 - C8 -3HB8 TYSY_HUMAN B:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
69 PsiBlast_CBE 67.3136% 8 - C8 -2RDA TYSY_HUMAN B:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
82 PsiBlast_CBE 67.3036% 4 - C8 -5HS3 ? B:[8-289] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
62 PsiBlast_CBE 67.1736% 5 - C8 -3H9K TYSY_HUMAN C:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
87 PsiBlast_CBE 67.1436% 8 - C8 -4H1I TYSY_HUMAN B:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
68 PsiBlast_CBE 67.0836% 7 - C8 -2RDA TYSY_HUMAN C:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
36 PsiBlast_CBE 66.9036% 4 - C8 -1JU6 TYSY_HUMAN C:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
71 PsiBlast_CBE 66.8236% 5 - C8 -2RD8 TYSY_HUMAN A:[32-308] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIK-----
20 PsiBlast_PDB 66.7236% 4 - C8 -1I00 TYSY_HUMAN A:[9-283] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
35 PsiBlast_CBE 66.5536% 5 - C8 -1JU6 TYSY_HUMAN D:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
41 PsiBlast_CBE 66.5036% 2 - C8 -3EJL TYSY_HUMAN D:[32-308] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIK-----
37 PsiBlast_CBE 66.3636% 5 - C8 -1JU6 TYSY_HUMAN B:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
11 PsiBlast_PDB 65.8236% 5 - C8 -1JU6 TYSY_HUMAN A:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
33 PsiBlast_CBE 65.5736% 9 - C8 -1JUJ TYSY_HUMAN C:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
32 PsiBlast_CBE 65.4936% 9 - C8 -1JUJ TYSY_HUMAN D:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
9 PsiBlast_PDB 65.4335% 6 - C8 -4EB4 TYSY_MOUSE A:[26-307] ------QYLRQVEHILRCGFKKE------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VRIWDANGSRDFLDSLGFSAR------------Q--------------------------------------------------EGDLGPVYGFQWRHFGAEY------KDM-------DSDYS-----------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVN------GELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKV-----------ETID---DFKVEDFQIEGYNPHPTIKMEMAV
98 PsiBlast_CBE 65.3836% -19 - C8 -3UM6 ? B:[327-608] ------QYLNIIYDIMMNG------------------NKQSDRTGVGVLSKFG-YIMKF--D-LS--QYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNK-N-VRIWEANGTREFLDNRKLFHR------------E--------------------------------------------------VNDLGPIYGFQWRHFGAEY------TNMYDNY---E---------------------------------NKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFD------GKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDI-----------KNIE---DFTISDFTIQNYVHHEKISMDMAA
34 PsiBlast_CBE 65.3236% 9 - C8 -1JUJ TYSY_HUMAN B:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
22 PsiBlast_CBE 65.2435% 10 - C8 -4EIN TYSY_MOUSE B:[26-306] ------QYLRQVEHILRCGFKKE------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VRIWDANGSRDFLDSLGFSAR------------Q--------------------------------------------------EGDLGPVYGFQWRHFGAEY------KDM-------DSDYS-----------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVN------GELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKV-----------ETID---DFKVEDFQIEGYNPHPTIKMEMA-
95 PsiBlast_CBE 65.2236% 18 - C8 -5BY6 ? C:[19-303] VNQEELNYLNQLKDIIDHGVRK------------------NDRTGIGTLSTFG-TQSRYCLR-DD--I-FPLLTTKRVFWRGVVEELLWFIS-GSTNAKQLSEKN-VNIWDGNSSREFLDSRGLYNY------------E--------------------------------------------------EGDLGPVYGFQWRHFGCPY------SSM-------TADYK-----------------------------GKGYDQLQQCIKMIREEPESRRIIMTAWNPCDLEKVALPPCHCFVQFYVAD------GELSCQMYQRSADMGLGVPFNIASYSLLTRMIAHITSLKPGFFIHTIGDAHVYLTHVDALKVQMERKPRPFPKLKILRNV-----------ENID---DFRAEDFELINYKPYPKISM----
12 PsiBlast_PDB 65.2236% 9 - C8 -1JUJ TYSY_HUMAN A:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
44 PsiBlast_CBE 65.1636% 11 - C8 -1I00 TYSY_HUMAN B:[9-283] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY---S---------------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
76 PsiBlast_CBE 65.1035% 10 - C8 -1RTS TYSY_RAT B:[26-303] ------QYLRQVEHIMRCGFKKE------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VRIWDANGSRDFLDSLGFSAR------------Q--------------------------------------------------EGDLGPVYGFQWRHFGADY------KDM-------DSDYS-----------------------------GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVN------GELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------ETID---DFKVEDFQIEGYNPHPTIKM----