@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0514: (2016-03-16 )
MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFNAMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNACPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DCP_A_3(2JAQ)
?
[Raw transfer]




DTP_C_12(2JAS)
?
[Raw transfer]




DCP_A_3(2JAQ)
?
[Raw transfer]




DTP_B_10(2JAS)
?
[Raw transfer]




DTP_A_7(2JAS)
?
[Raw transfer]




DTP_F_17(2JAS)
?
[Raw transfer]




DTP_E_15(2JAS)
?
[Raw transfer]




DTP_D_13(2JAS)
?
[Raw transfer]




DCM_B_8(2JAT)
?
[Raw transfer]




DCM_A_5(2JAT)
?
[Raw transfer]




58 HHSearch 91.8631%-103 * C1 *2JAQ 8.7 ?
4 PsiBlast_PDB 91.2426%-102 - C1 -2A2Z - DCK_HUMAN -
59 HHSearch 88.7724% -98 - C1 -1P5Z - DCK_HUMAN -
8 PsiBlast_PDB 88.1724% -99 - C1 -1P60 - DCK_HUMAN -
5 PsiBlast_PDB 87.4424% -94 - C1 -3IPX - DCK_HUMAN -
6 PsiBlast_PDB 87.0224%-103 - C1 -3IPY - DCK_HUMAN -
11 PsiBlast_PDB 86.9724% -97 - C1 -2A7Q - DCK_HUMAN -
16 PsiBlast_PDB 86.6824% -93 - C1 -4JLJ - DCK_HUMAN -
10 PsiBlast_PDB 86.5224% -97 - C1 -1P62 - DCK_HUMAN -
9 PsiBlast_PDB 86.4924% -95 - C1 -1P61 - DCK_HUMAN -
14 PsiBlast_PDB 86.1624% -97 - C1 -4JLK - DCK_HUMAN -
17 PsiBlast_PDB 85.8224% -92 - C1 -4JLM - DCK_HUMAN -
7 PsiBlast_PDB 85.7924% -99 - C1 -1P5Z - DCK_HUMAN -
15 PsiBlast_PDB 85.2224% -98 - C1 -4L5B - DCK_HUMAN -
18 PsiBlast_PDB 84.8724% -97 - C1 -4JLN - DCK_HUMAN -
13 PsiBlast_PDB 84.7424% -92 - C1 -3QEN - DCK_HUMAN -
19 PsiBlast_PDB 84.4324% -95 - C1 -4KCG - DCK_HUMAN -
12 PsiBlast_PDB 83.9424% -92 - C1 -3QEJ - DCK_HUMAN -
20 PsiBlast_PDB 83.3924% -93 - C1 -4Q18 - DCK_HUMAN -
57 HHSearch 81.5724% -88 - C1 -2OCP - DGUOK_HUMAN -
22 PsiBlast_CBE 78.1435% -67 - C1 -2JAS 7.2 ?
26 PsiBlast_CBE 76.9735% -65 - C1 -2JAS 7.9 ?
1 PsiBlast_PDB 76.9035% -80 - C1 -2JAQ 8.7 ?
21 PsiBlast_CBE 76.0635% -76 - C1 -2JAT 5.3 ?
2 PsiBlast_PDB 75.8635% -81 - C1 -2JAT 5.4 ?
23 PsiBlast_CBE 74.1335% -71 - C1 -2JAS 9.0 ?
25 PsiBlast_CBE 74.0835% -65 - C1 -2JAS 8.3 ?
3 PsiBlast_PDB 71.2035% -62 - C1 -2JAS 7.0 ?
24 PsiBlast_CBE 70.1635% -69 - C1 -2JAS 6.8 ?