@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2545: (2016-04-04 )
MRIRVPATTANLGPGFDSCGLALTLYLTLDIGAEADSWYIEHNIGGGIPHDETNVIIETALNLAPNLTPHHLVMTCDIPPARGLGSSSAAVVAGIELANTLAELNLSKEEKVRIAAEIEGHPDNVAPAVLGNWVVGAKLDGEDFYVRHLFPDCALIAFIPKAELLTSESRGVLPDTLPFKEAVQASSIANVMIAAILRNDMTLAGEMMERDLWHEKYRSQLVPHLAQIRDVAKNQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTLEIDADVLLLDVEGSGAEVFR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HSE_C_2(1H72)
KHSE_METJA
[Raw transfer]



ILE_A_5(1H74)
KHSE_METJA
[Raw transfer]



THR_A_2(1H73)
KHSE_METJA
[Raw transfer]
1 PsiBlast_PDB 98.6399%-133 - C1 -3HUL - KHSE_LISMO -
18 HHSearch 98.1197%-133 - C1 -3HUL - KHSE_LISMO -
17 PsiBlast_CBE 94.7599%-131 - C1 -3HUL - KHSE_LISMO -
19 HHSearch 69.8529% -96 - C1 -1H72 - KHSE_METJA -
43 Fugue 66.2728% -93 - C1 -1H74 - KHSE_METJA -
42 Fugue 65.5928% -91 - C1 -1FWK - KHSE_METJA -
41 Fugue 64.8028% -91 * C1 *1H72 - KHSE_METJA -
44 Fugue 63.4526%-101 - C1 -1H72 - KHSE_METJA -
2 PsiBlast_PDB 61.2328% -94 - C1 -4RPF - KHSE_YERPN -
29 HHSearch 59.6617%-107 - C1 -2CZ9 - GAL1_PYRHO -
26 HHSearch 58.7020%-112 - C1 -2V8P - ISPE_AQUAE -
36 HHSearch 57.5619% -93 - C1 -1KKH - MVK_METJA -
6 PsiBlast_PDB 56.8726% -99 - C1 -1H72 3.6 KHSE_METJA
30 HHSearch 55.9818%-100 - C1 -2GS8 - ? -
8 PsiBlast_PDB 55.8826% -98 - C1 -1H73 3.3 KHSE_METJA
7 PsiBlast_PDB 55.5326% -99 - C1 -1H74 5.1 KHSE_METJA
24 HHSearch 55.0318% -95 - C1 -1WUU - GALK1_HUMAN -
20 HHSearch 54.9221% -94 - C1 -3PYF - ISPE_MYCTU -
5 PsiBlast_PDB 54.8126% -99 - C1 -1FWL - KHSE_METJA -
4 PsiBlast_PDB 54.6226% -96 - C1 -1FWK - KHSE_METJA -