@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 679_tII_BRADI: (2014-05-13 )
MMVAAQCDAGQLVVCAPAILGGAMPTASCCSKLREQEQQGCFCEYLRNPAYAGYINSQTARGAIAACNVTLPQCS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
10 HHSearch 83.3357%-122 - C4 -1L6H - NLTPX_ORYSJ -
9 HHSearch 82.9351%-118 - C4 -1N89 5.6 NLT2G_WHEAT
22 SP3 81.0352%-121 - C4 -1L6H - NLTPX_ORYSJ -
1 Fugue 79.9453%-120 - C4 -1L6H - NLTPX_ORYSJ -
23 SP3 68.6925% -99 - C4 -1FK5 - NLTP_MAIZE -
17 HHSearch 65.9427%-101 - C4 -1T12 - NLTP1_TOBAC -
16 HHSearch 65.8332% -90 - C4 -1AFH - NLTP_MAIZE -
3 Fugue 65.6716%-125 - C4 -1S6D - 2SS8_HELAN -
2 Fugue 63.8820%-102 - C4 -2RKN - DIRL1_ARATH -
11 HHSearch 62.6023%-100 - C4 -2RKN - DIRL1_ARATH -
24 SP3 60.3722%-112 - C4 -1HYP - ? -
14 HHSearch 60.0326%-104 - C4 -1SIY - NLTP1_VIGRR -
13 HHSearch 58.7329% -91 - C4 -2ALG - NLTP1_PRUPE -
12 HHSearch 57.2025% -76 - C4 -1BWO - NLTP1_WHEAT -
19 HHSearch 54.4321%-100 - C4 -1HYP - HPSE_SOYBN -
26 SP3 49.9917%-125 * C4 *1XPJ - ? -
30 SP3 44.5418% -95 - C5 -1ATG - ? -
29 SP3 41.8216%-130 * C5 *1VLW - ? -
31 SP3 40.1017%-112 - C4 -3FRU - FCGRN_RAT -
7 Fugue 39.0922% -75 - C2 -3ACP - RPN14_YEAST -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
37 91.63100%-126 - C- -M037 - -
39 90.46100%-141 - C- -M039 - -