@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0441: (2016-03-15 )
MKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVDAFHQF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2BA_C_6(4D3H)
?
[Raw transfer]




2BA_B_5(4D3H)
?
[Raw transfer]




2BA_A_2(4WK1)
?
[Raw transfer]




2BA_C_6(4D3H)
?
[Raw transfer]




2BA_C_7(4RWW)
?
[Raw transfer]




2BA_A_4(4RWW)
?
[Raw transfer]




2BA_B_6(4RWW)
?
[Raw transfer]




14 PsiBlast_CBE 91.46100%-152 - C1 -4D3H 6.9 ?
15 PsiBlast_CBE 91.20100%-139 - C1 -4D3H 6.9 ?
4 PsiBlast_PDB 90.14100%-146 - C1 -4D3H 6.1 ?
2 PsiBlast_PDB 89.69100%-169 - C1 -4WK3 - ? -
1 PsiBlast_PDB 87.14100%-157 - C1 -4WK1 6.2 ?
3 PsiBlast_PDB 85.50100%-159 - C1 -4D3G - ? -
5 PsiBlast_PDB 83.0865%-145 - C1 -4RLE - YAAQ_BACSU -
17 PsiBlast_CBE 81.1361%-152 - C1 -4RWW 7.7 ?
7 PsiBlast_PDB 80.1261%-141 - C1 -4RWW 7.5 ?
16 PsiBlast_CBE 79.8161%-153 - C1 -4RWW 6.8 ?
18 HHSearch 77.0349%-135 - C1 -3M05 - ? -
8 PsiBlast_PDB 75.3948%-136 - C1 -3M05 - ? -
6 PsiBlast_PDB 74.3261%-156 - C1 -4RWX - ? -
19 HHSearch 65.5226%-155 - C1 -2EG2 - GLNB_AQUAE -
24 HHSearch 64.9429%-145 - C1 -3T9Z - ? -
25 HHSearch 64.7230%-142 - C1 -3L7P - ? -
22 HHSearch 63.1327%-143 - C1 -3NCQ - ? -
27 HHSearch 62.5520%-135 - C1 -2J9C - Y059_METJA -
21 HHSearch 61.1424%-142 - C1 -2GW8 - ? -
26 HHSearch 61.0024%-140 - C1 -3BZQ - GLNB_MYCTU -