@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0717: (2016-03-18 )
MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGNQSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANATILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CYS_A_5(1SSQ)
CYSE_HAEIN
[Raw transfer]




2 PsiBlast_PDB 82.8433%-132 - C2 -4ISX - ? -
1 PsiBlast_PDB 81.4433%-127 - C2 -3SRT - ? -
113 HHSearch 80.8941%-129 - C2 -3SRT - ? -
115 HHSearch 75.5443%-122 - C2 -1OCX - MAA_ECOLI -
8 PsiBlast_PDB 73.5839%-141 - C2 -2IC7 - ? -
9 PsiBlast_PDB 73.0739%-137 - C2 -2P2O - ? -
22 PsiBlast_CBE 72.7845%-155 - C2 -1OCX - MAA_ECOLI -
3 PsiBlast_PDB 72.5745%-156 - C2 -1OCX - MAA_ECOLI -
21 PsiBlast_CBE 72.3845%-154 - C2 -1OCX - MAA_ECOLI -
23 PsiBlast_CBE 70.1041%-129 - C2 -3V4E - ATRF2_STAAC -
116 HHSearch 69.8932%-119 - C2 -3NZ2 - ? -
24 PsiBlast_CBE 69.0241%-126 - C2 -3V4E - ATRF2_STAAC -
43 PsiBlast_CBE 68.9937%-148 - C2 -4N6A - ? -
29 PsiBlast_CBE 68.2341%-133 - C2 -4EGG - ATRF2_STAAC -
5 PsiBlast_PDB 68.0941%-131 - C2 -3V4E - ATRF2_STAAC -
129 HHSearch 67.6734%-101 - C2 -1MR7 - VATD_ENTFC -
26 PsiBlast_CBE 67.4341%-139 - C2 -4EGG - ATRF2_STAAC -
28 PsiBlast_CBE 66.7841%-131 - C2 -4EGG - ATRF2_STAAC -
7 PsiBlast_PDB 66.7541%-138 - C2 -3FTT - ATRF2_STAAC -
40 PsiBlast_CBE 66.6637%-141 - C2 -4N6B - ? -