@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1197: (2016-03-23 )
MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADTSQLDKAKSIGIINEKCLNYSEAIKKADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHESNLLKHNIHLVSGHPMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDYVTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNKTYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVDIPDESGMISKVTYIMSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDCYIQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_5(3GGP)
?
[Raw transfer]




NAI_A_5(3GGO)
?
[Raw transfer]




NAD_A_2(3B1F)
?
[Raw transfer]




NAD_A_2(3B1F)
?
[Raw transfer]




TYR_A_3(4WJI)
?
[Raw transfer]




23 HHSearch 91.1539% -87 - C2 -3B1F 8.0 ?
2 PsiBlast_PDB 90.9738% -90 - C2 -3B1F 8.0 ?
4 PsiBlast_PDB 86.1730% -80 - C2 -3GGG - ? -
6 PsiBlast_PDB 84.8130% -78 - C2 -3GGP 9.1 ?
21 HHSearch 84.6731% -81 - C2 -2G5C - ? -
5 PsiBlast_PDB 83.3730% -77 - C2 -3GGO 9.5 ?
7 PsiBlast_PDB 81.4830% -76 - C2 -2G5C - ? -
22 HHSearch 73.7721% -64 - C2 -3KTD - ? -
3 PsiBlast_PDB 72.9132% -54 - C2 -4WJI 2.9 ?
1 PsiBlast_PDB 63.2238% -11 - C2 -3DZB - ? -
45 Fugue 61.0020% -71 - C2 -2PV7 - TYRA_HAEIN -
41 HHSearch 57.7516% -83 * C2 *3DOJ - GLYR1_ARATH -
37 HHSearch 56.7621% -85 - C2 -3ADO - CRYL1_RABIT -
35 HHSearch 55.5417% -81 - C2 -3OBB - SERDH_PSEAE -
27 HHSearch 55.0117% -95 - C2 -2RCY - ? -
30 HHSearch 54.1216% -63 - C2 -1YGY - SERA_MYCTU -
52 Fugue 53.3611% -72 - C2 -1EVY - GPDA_LEIME -
31 HHSearch 52.2117% -74 - C2 -2IZZ - P5CR1_HUMAN -
40 HHSearch 51.8717% -78 - C2 -3QHA - ? -
47 Fugue 51.8414% -67 - C2 -3DOJ - GLYR1_ARATH -