@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1497: (2016-03-25 )
MTKKPIVVGVTGGSGSGKTSVTKAICNHFSGHSILMIAQDVYYHDQANISFEDRLKVNYDHPLAFDTDLLISHIAALRRYESIEKPIYDYAKYTRKKEVEIQEPREVIILEGILILEDKRLRDLMDIKVYVDTDDDIRFIRRLLRDMKERGRTMDSVIEQYLSVVKPMHNEFIEPTKKFADIIIPEGGENHVAIDLMTTKIESILQKHV

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CTP_C_3(1UDW)
UCK2_HUMAN
[Raw transfer]




CTP_D_4(1UDW)
UCK2_HUMAN
[Raw transfer]




UTP_D_4(1UEI)
UCK2_HUMAN
[Raw transfer]




UTP_C_3(1UEI)
UCK2_HUMAN
[Raw transfer]




C5P_A_3(3ASZ)
URK_THET8
[Raw transfer]




C5P_B_4(3ASZ)
URK_THET8
[Raw transfer]




ACP_B_6(3W34)
URK_THET8
[Raw transfer]




ACP_A_4(3W34)
URK_THET8
[Raw transfer]




ACP_A_4(3W34)
URK_THET8
[Raw transfer]




CTN_D_4(1UEJ)
UCK2_HUMAN
[Raw transfer]




CTN_C_3(1UEJ)
UCK2_HUMAN
[Raw transfer]




ADP_A_5(2UVQ)
UCK1_HUMAN
[Raw transfer]




CIT_F_6(1UEJ)
UCK2_HUMAN
[Raw transfer]




ADP_A_6(1UJ2)
UCK2_HUMAN
[Raw transfer]




ADP_A_6(1UJ2)
UCK2_HUMAN
[Raw transfer]




ADP_A_5(2UVQ)
UCK1_HUMAN
[Raw transfer]




ACP_B_6(3W8R)
URK_THET8
[Raw transfer]




ADP_B_8(1XRJ)
UCK2_HUMAN
[Raw transfer]




ADP_A_6(1XRJ)
UCK2_HUMAN
[Raw transfer]




ACP_A_4(3W8R)
URK_THET8
[Raw transfer]




ADP_B_8(1UJ2)
UCK2_HUMAN
[Raw transfer]




CIT_E_5(1UEJ)
UCK2_HUMAN
[Raw transfer]




58 HHSearch 94.4048%-101 * C1 *3W34 3.3 URK_THET8
2 PsiBlast_PDB 89.0749% -98 - C1 -3ASZ 7.7 URK_THET8
23 PsiBlast_CBE 88.8249% -97 - C1 -3W8R 3.9 URK_THET8
1 PsiBlast_PDB 88.4849% -97 - C1 -3ASY - URK_THET8 -
4 PsiBlast_PDB 88.2249% -91 - C1 -3W8R 2.1 URK_THET8
3 PsiBlast_PDB 88.1449% -94 - C1 -3W34 3.3 URK_THET8
21 PsiBlast_CBE 87.7649% -99 - C1 -3W34 3.9 URK_THET8
22 PsiBlast_CBE 86.9949% -89 - C1 -3ASZ 6.7 URK_THET8
60 HHSearch 86.8337%-102 - C1 -2JEO - UCK1_HUMAN -
9 PsiBlast_PDB 86.6937% -96 - C1 -1UFQ - UCK2_HUMAN -
57 HHSearch 86.3438% -95 - C1 -1UJ2 6.0 UCK2_HUMAN
8 PsiBlast_PDB 86.3037%-100 - C1 -1UEJ 5.3 UCK2_HUMAN
27 PsiBlast_CBE 85.7437% -92 - C1 -1UEI 9.0 UCK2_HUMAN
28 PsiBlast_CBE 85.0637% -97 - C1 -1UDW 8.7 UCK2_HUMAN
5 PsiBlast_PDB 84.4537% -97 - C1 -1XRJ 6.2 UCK2_HUMAN
10 PsiBlast_PDB 84.4437% -95 - C1 -1UJ2 6.1 UCK2_HUMAN
6 PsiBlast_PDB 84.2937% -95 - C1 -1UDW 9.2 UCK2_HUMAN
11 PsiBlast_PDB 84.2135%-103 - C1 -2JEO - UCK1_HUMAN -
26 PsiBlast_CBE 84.1937% -98 - C1 -1UEJ 6.0 UCK2_HUMAN
7 PsiBlast_PDB 84.0537% -95 - C1 -1UEI 9.2 UCK2_HUMAN
24 PsiBlast_CBE 83.9637% -95 - C1 -1XRJ 5.4 UCK2_HUMAN
12 PsiBlast_PDB 83.3335%-102 - C1 -2UVQ 6.0 UCK1_HUMAN
48 Fugue 82.6635%-101 - C1 -2UVQ 6.0 UCK1_HUMAN
25 PsiBlast_CBE 82.5737% -93 - C1 -1UJ2 6.3 UCK2_HUMAN