@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1782: (2016-03-28 )
VKLISWNVNGLRAAVKKGFLEYFEEVDADIFCLQETKLQEGQIELDLPAYKDYWNYAVKKGYSGTAIFTKVEPLSVQYGLGIPEHDTEGRVITLEFEEFFMVTVYTPNSQAELKRLDYRMTFEDAILEYVKNLDNTKPVVLCGDLNVAHEEIDLKNPKTNRKNAGFSDEERAKFSAFLDAGFIDSFRYFYPDLTDAYSWWSYRMNARARNTGWRIDYFVVSERLKDKLVDAKIHADVLGSDHCPVELELNL

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UNL_A_13(3MPR)
?
[Raw transfer]




UNL_A_16(3MPR)
?
[Raw transfer]




PEG_A_10(3W2Y)
?
[Raw transfer]




NACID_X_1(1DEW)
APEX1_HUMAN
[Raw transfer]

-

NACID_U_3(1DEW)
APEX1_HUMAN
[Raw transfer]

-

FMT_A_13(3W2Y)
?
[Raw transfer]




NACID_W_6(1DE9)
APEX1_HUMAN
[Raw transfer]

-

MPD_A_9(3G00)
?
[Raw transfer]




GOL_A_15(3G2D)
?
[Raw transfer]




NACID_H_3(3G4T)
?
[Raw transfer]

-

NACID_H_5(3GA6)
?
[Raw transfer]

-

NACID_H_3(3G00)
?
[Raw transfer]

-

GOL_A_10(3G0R)
?
[Raw transfer]




FMT_A_11(3W2Y)
?
[Raw transfer]




NACID_H_3(3G4T)
?
[Raw transfer]

-

MPD_B_12(3G00)
?
[Raw transfer]




FMT_A_5(3W2Y)
?
[Raw transfer]




NACID_P_16(4IEM)
APEX1_HUMAN
[Raw transfer]

-

NACID_H_3(3G00)
?
[Raw transfer]

-

NACID_M_12(4IEM)
APEX1_HUMAN
[Raw transfer]

-

NACID_J_8(4IEM)
APEX1_HUMAN
[Raw transfer]

-

NACID_H_3(3G3C)
?
[Raw transfer]

-

FMT_A_5(3W2X)
?
[Raw transfer]




NACID_G_3(3G0R)
?
[Raw transfer]

-

NACID_F_3(3GA6)
?
[Raw transfer]

-

NACID_I_4(3G3C)
?
[Raw transfer]

-

NACID_G_3(3G0R)
?
[Raw transfer]

-

NACID_G_2(3G38)
?
[Raw transfer]

-

NACID_V_3(4B5J)
?
[Raw transfer]

-

NACID_I_4(3G3C)
?
[Raw transfer]

-

NACID_V_8(4B5M)
?
[Raw transfer]

-

NACID_V_3(4B5H)
?
[Raw transfer]

-

NACID_V_5(4B5G)
?
[Raw transfer]

-

NACID_V_4(1DE8)
APEX1_HUMAN
[Raw transfer]

-

NACID_Z_12(4B5M)
?
[Raw transfer]

-

NACID_K_4(3G2D)
?
[Raw transfer]

-

NACID_V_3(4B5F)
?
[Raw transfer]

-

NACID_Z_9(4B5G)
?
[Raw transfer]

-

NACID_I_3(3G2C)
?
[Raw transfer]

-

NACID_X_7(4B5G)
?
[Raw transfer]

-

NACID_V_3(4B5I)
?
[Raw transfer]

-

NACID_I_6(3G2D)
?
[Raw transfer]

-

NACID_Y_2(1DE8)
APEX1_HUMAN
[Raw transfer]

-

NACID_X_10(4B5M)
?
[Raw transfer]

-

NACID_I_3(3G2C)
?
[Raw transfer]

-

NACID_Z_3(1DE9)
APEX1_HUMAN
[Raw transfer]

-

NACID_I_3(3G3Y)
?
[Raw transfer]

-

1 PsiBlast_PDB 97.3755%-100 - C1 -2O3C - APEX1_DANRE -
22 PsiBlast_CBE 96.4055% -99 - C1 -2O3C - APEX1_DANRE -
12 PsiBlast_PDB 96.3850%-101 - C1 -3U8U - APEX1_HUMAN -
9 PsiBlast_PDB 95.4550% -99 - C1 -1BIX - APEX1_HUMAN -
31 PsiBlast_CBE 95.1450%-101 - C1 -3U8U - APEX1_HUMAN -
21 PsiBlast_CBE 95.1155% -99 - C1 -2O3C - APEX1_DANRE -
35 PsiBlast_CBE 95.0950% -98 - C1 -2ISI - APEX1_HUMAN -
28 PsiBlast_CBE 94.9250% -97 - C1 -4IEM Error APEX1_HUMAN
24 PsiBlast_CBE 94.9050% -92 - C1 -4LND - APEX1_HUMAN -
32 PsiBlast_CBE 94.7650% -99 - C1 -3U8U - APEX1_HUMAN -
4 PsiBlast_PDB 94.7550% -95 - C1 -4QHE - APEX1_HUMAN -
3 PsiBlast_PDB 94.7050% -99 - C1 -4QHD - APEX1_HUMAN -
5 PsiBlast_PDB 94.5550% -96 - C1 -4LND - APEX1_HUMAN -
8 PsiBlast_PDB 94.5350% -98 - C1 -2O3H - APEX1_HUMAN -
26 PsiBlast_CBE 94.2850%-101 - C1 -1DE8 5.1 APEX1_HUMAN
25 PsiBlast_CBE 94.1250%-101 - C1 -1DE9 6.5 APEX1_HUMAN
38 PsiBlast_CBE 94.0850%-100 - C1 -1DEW 5.7 APEX1_HUMAN
27 PsiBlast_CBE 94.0050% -99 - C1 -4IEM Error APEX1_HUMAN
23 PsiBlast_CBE 93.9850% -92 - C1 -4LND - APEX1_HUMAN -
2 PsiBlast_PDB 93.5950% -98 - C1 -4QH9 - APEX1_HUMAN -
29 PsiBlast_CBE 93.4650% -98 - C1 -4IEM Error APEX1_HUMAN
7 PsiBlast_PDB 93.1150%-101 - C1 -1DE9 6.8 APEX1_HUMAN
14 PsiBlast_PDB 92.6050% -94 - C1 -1DEW 4.9 APEX1_HUMAN
15 PsiBlast_PDB 92.5546%-100 - C1 -3W2X 2.8 ?
6 PsiBlast_PDB 92.1150%-100 - C1 -1DE8 4.8 APEX1_HUMAN
16 PsiBlast_PDB 91.9646% -98 - C1 -3W2Y 3.6 ?
42 PsiBlast_CBE 91.0646% -93 - C1 -3G3Y 7.2 ?
41 PsiBlast_CBE 90.9146% -93 - C1 -3G4T 2.7 ?
53 PsiBlast_CBE 90.5746% -94 - C1 -3G2D 5.4 ?
39 PsiBlast_CBE 90.5746% -96 - C1 -3W2Y 2.8 ?
45 PsiBlast_CBE 90.5446% -94 - C1 -3G3C 2.6 ?
40 PsiBlast_CBE 90.4546% -92 - C1 -3G4T 5.8 ?
56 PsiBlast_CBE 90.1146% -94 - C1 -3G0R 5.3 ?
58 PsiBlast_CBE 90.0046% -94 - C1 -3G00 4.9 ?
55 PsiBlast_CBE 89.9346% -96 - C1 -3G0R 7.2 ?
54 PsiBlast_CBE 89.7146% -95 - C1 -3G2D 6.2 ?
46 PsiBlast_CBE 89.6946% -96 - C1 -3G2C 7.9 ?
44 PsiBlast_CBE 89.5446% -93 - C1 -3G3C 4.5 ?
20 PsiBlast_PDB 89.1946% -93 - C1 -3G2C 2.0 ?
57 PsiBlast_CBE 89.1046% -97 - C1 -3G00 2.7 ?
52 PsiBlast_CBE 89.0446% -96 - C1 -3G38 2.9 ?
50 PsiBlast_CBE 89.0146% -95 - C1 -3GA6 4.1 ?
49 PsiBlast_CBE 88.2746% -91 - C1 -3GA6 4.7 ?
66 PsiBlast_CBE 86.0241% -88 - C1 -4B5G 5.5 ?
64 PsiBlast_CBE 86.0041% -90 - C1 -4B5G 5.3 ?
62 PsiBlast_CBE 85.7841% -86 - C1 -4B5J 6.4 ?
63 PsiBlast_CBE 85.4541% -86 - C1 -4B5I 6.7 ?
65 PsiBlast_CBE 85.4141% -83 - C1 -4B5G 6.9 ?
67 PsiBlast_CBE 84.7641% -87 - C1 -4B5F 4.5 ?
68 PsiBlast_CBE 83.4641% -89 - C1 -4B5H 4.8 ?
59 PsiBlast_CBE 83.3741% -86 - C1 -4B5M 4.0 ?
61 PsiBlast_CBE 83.1741% -86 - C1 -4B5M 4.9 ?
60 PsiBlast_CBE 82.8341% -85 - C1 -4B5M 5.6 ?