@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2592: (2016-04-05 )
MKTVKLNNGVEVPILGFGTYQITDAAEAEHAVKDAIKAGYRHIDTAQSYMNEEAVGRGIAASGVDRKELFITTKIWVENVSYKGVMSSFDRSLKRLGLDYVDLLLIHQPFNDVYGAWIAMEELQASGKIRAIGVSNFSPDRVIDLAAFNEVTPQVNQIEVNPFQQQTANLAILRKEGVAIEAWAPFAEGKNDIFNNPVLTKIGAKYGKSAAQVILRWLVEQDIIVLAKSVKPERMAQNLAIFDFELTEADKEEIAGLDQGESQFFSHADPEMVKWMASRKLNV

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_B_4(1VP5)
?
[Raw transfer]




NAP_A_3(1VP5)
?
[Raw transfer]




NAP_A_3(1VP5)
?
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




NAP_B_2(1A80)
DKGA_CORSC
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NDP_B_6(3WBW)
?
[Raw transfer]




NAP_B_8(4JQ1)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NAP_A_4(4JQA)
AK1C2_HUMAN
[Raw transfer]




NAP_B_8(4JQ3)
AK1C2_HUMAN
[Raw transfer]




NDP_A_7(2HDJ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JTR)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JQ4)
AK1C2_HUMAN
[Raw transfer]




NDP_A_3(3D3F)
GR_BACSU
[Raw transfer]




NDP_A_3(4G5D)
PGFS_LEIMA
[Raw transfer]




NAP_A_4(4JQ3)
AK1C2_HUMAN
[Raw transfer]




NAP_B_8(4JQA)
AK1C2_HUMAN
[Raw transfer]




NAP_B_7(1J96)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JTQ)
AK1C2_HUMAN
[Raw transfer]




NAP_B_9(4JTR)
AK1C2_HUMAN
[Raw transfer]




NDP_B_4(4G5D)
PGFS_LEIMA
[Raw transfer]




NAP_A_3(4L1X)
AK1C2_HUMAN
[Raw transfer]




NAD_C_3(1M9H)
DKGA_CORSC
[Raw transfer]




NAP_A_3(1S1P)
AK1C3_HUMAN
[Raw transfer]




NAP_A_5(1J96)
AK1C2_HUMAN
[Raw transfer]




NDP_A_4(3WBW)
?
[Raw transfer]




NAP_B_6(4L1X)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JQ2)
AK1C2_HUMAN
[Raw transfer]




NAP_C_3(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_A_4(4JQ1)
AK1C2_HUMAN
[Raw transfer]




NAP_B_10(4JQ4)
AK1C2_HUMAN
[Raw transfer]




NDP_B_4(3D3F)
GR_BACSU
[Raw transfer]




NAP_B_8(4JTQ)
AK1C2_HUMAN
[Raw transfer]




NAP_C_3(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_A_2(3H7R)
AKRC8_ARATH
[Raw transfer]




NAP_C_3(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_D_4(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_D_4(1VBJ)
PGFS_TRYBB
[Raw transfer]




NDP_B_8(2HDJ)
AK1C2_HUMAN
[Raw transfer]




NAP_B_8(4JQ2)
AK1C2_HUMAN
[Raw transfer]




NA7_A_3(2WZM)
Y2407_MYCS2
[Raw transfer]




NA7_A_3(2WZM)
Y2407_MYCS2
[Raw transfer]




NA7_B_4(2WZM)
Y2407_MYCS2
[Raw transfer]




GOL_H_8(1MZR)
DKGA_ECOLI
[Raw transfer]




GOL_C_10(3O0K)
?
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




GOL_I_9(1MZR)
DKGA_ECOLI
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




GOL_C_10(3O0K)
?
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




GLU_A_3(4FZI)
PGFS_TRYCC
[Raw transfer]




GLU_B_4(4FZI)
PGFS_TRYCC
[Raw transfer]




EDO_A_10(4F40)
PGFS_LEIMA
[Raw transfer]




EDO_B_20(4F40)
PGFS_LEIMA
[Raw transfer]




CIT_E_5(1VBJ)
PGFS_TRYBB
[Raw transfer]




CIT_F_6(1VBJ)
PGFS_TRYBB
[Raw transfer]




1 PsiBlast_PDB 96.8758% -91 - C7 -4MHB - ? -
2 PsiBlast_PDB 95.5055% -93 - C7 -1VP5 13.0 ?
21 PsiBlast_CBE 95.1055% -95 - C7 -1VP5 12.6 ?
101 HHSearch 93.6755% -87 - C7 -1VP5 13.0 ?
105 HHSearch 88.5446%-100 - C7 -3O0K 2.6 ?
10 PsiBlast_PDB 86.9441% -97 - C7 -4GIE 12.6 PGFS_TRYCC
119 HHSearch 86.9340% -87 - C7 -1MZR 3.2 DKGA_ECOLI
6 PsiBlast_PDB 86.9045% -97 - C7 -3O0K 2.6 ?
29 PsiBlast_CBE 86.6946% -92 - C7 -3F7J - GR_BACSU -
26 PsiBlast_CBE 86.6845% -98 - C7 -3O0K 2.8 ?
25 PsiBlast_CBE 86.6845% -97 - C7 -3O0K 2.6 ?
103 HHSearch 86.5540% -95 - C7 -2WZM 8.0 Y2407_MYCS2
3 PsiBlast_PDB 86.4945% -86 - C7 -1VBJ 12.5 PGFS_TRYBB
5 PsiBlast_PDB 86.4744% -95 - C7 -4G5D 12.3 PGFS_LEIMA
33 PsiBlast_CBE 86.3940% -91 - C7 -4Q3M - ? -
32 PsiBlast_CBE 86.2340% -89 - C7 -4Q3M - ? -
27 PsiBlast_CBE 86.1845%-101 - C7 -3O0K 2.6 ?
11 PsiBlast_PDB 86.0640% -91 - C7 -4Q3M - ? -
7 PsiBlast_PDB 85.9546% -91 - C7 -3D3F 11.9 GR_BACSU
34 PsiBlast_CBE 85.9040% -91 - C7 -4Q3M - ? -
102 HHSearch 85.6246% -88 - C7 -1VBJ 12.5 PGFS_TRYBB
13 PsiBlast_PDB 85.6239% -94 - C7 -2WZM 8.0 Y2407_MYCS2
24 PsiBlast_CBE 85.5444% -98 - C7 -4F40 2.6 PGFS_LEIMA
22 PsiBlast_CBE 85.4645% -85 - C7 -1VBJ 11.0 PGFS_TRYBB
19 PsiBlast_PDB 85.4339% -86 - C7 -1A80 7.7 DKGA_CORSC
28 PsiBlast_CBE 85.3946% -94 - C7 -3D3F 11.5 GR_BACSU
9 PsiBlast_PDB 85.3241% -95 - C7 -4FZI 2.5 PGFS_TRYCC
15 PsiBlast_PDB 85.2940% -87 - C7 -1MZR 3.0 DKGA_ECOLI
4 PsiBlast_PDB 85.2744% -95 - C7 -4F40 2.6 PGFS_LEIMA
36 PsiBlast_CBE 85.2239% -93 - C7 -2WZM 8.5 Y2407_MYCS2
20 PsiBlast_PDB 85.0539% -86 - C7 -1M9H 5.4 DKGA_CORSC
23 PsiBlast_CBE 84.8944% -94 - C7 -4G5D 12.8 PGFS_LEIMA
30 PsiBlast_CBE 84.7641% -95 - C7 -4FZI 2.1 PGFS_TRYCC
99 PsiBlast_CBE 84.6632% -93 - C7 -4L1X 4.4 AK1C2_HUMAN
87 PsiBlast_CBE 84.5232% -96 - C7 -4JTQ 12.9 AK1C2_HUMAN
83 PsiBlast_CBE 84.4032% -95 - C7 -1J96 13.0 AK1C2_HUMAN
84 PsiBlast_CBE 84.3832% -97 - C7 -1J96 12.6 AK1C2_HUMAN
85 PsiBlast_CBE 83.8432% -96 - C7 -4JTR 12.5 AK1C2_HUMAN
89 PsiBlast_CBE 83.8332% -95 - C7 -4JQA 12.1 AK1C2_HUMAN
117 HHSearch 83.7040% -88 - C7 -3H7U 10.0 AKRC9_ARATH
80 PsiBlast_CBE 83.6532% -95 - C7 -2HDJ 12.1 AK1C2_HUMAN
79 PsiBlast_CBE 83.6432% -96 - C7 -2HDJ 12.0 AK1C2_HUMAN
98 PsiBlast_CBE 83.6232% -94 * C7 *4JQ1 12.6 AK1C2_HUMAN
95 PsiBlast_CBE 83.5932% -94 - C7 -4JQ2 12.3 AK1C2_HUMAN
97 PsiBlast_CBE 83.4932% -95 - C7 -4JQ1 13.0 AK1C2_HUMAN
110 HHSearch 83.4035% -94 - C7 -1S1P 13.0 AK1C3_HUMAN
92 PsiBlast_CBE 83.3632% -98 - C7 -4JQ4 12.9 AK1C2_HUMAN
90 PsiBlast_CBE 83.2732% -94 - C7 -4JQA 12.7 AK1C2_HUMAN
86 PsiBlast_CBE 83.2232% -94 - C7 -4JTR 12.8 AK1C2_HUMAN
44 PsiBlast_CBE 83.2134% -88 - C7 -3WBW 10.8 ?
88 PsiBlast_CBE 83.2032% -96 - C7 -4JTQ 12.8 AK1C2_HUMAN
96 PsiBlast_CBE 83.1832% -96 - C7 -4JQ2 12.8 AK1C2_HUMAN
94 PsiBlast_CBE 83.1032% -92 - C7 -4JQ3 4.6 AK1C2_HUMAN
93 PsiBlast_CBE 83.0832% -95 - C7 -4JQ3 11.3 AK1C2_HUMAN
100 PsiBlast_CBE 83.0032% -95 - C7 -4L1X 5.1 AK1C2_HUMAN
45 PsiBlast_CBE 82.5434% -90 - C7 -3WBW 11.4 ?
82 PsiBlast_CBE 82.3732% -93 - C7 -1IHI 12.1 AK1C2_HUMAN
81 PsiBlast_CBE 82.3132% -92 - C7 -1IHI 11.7 AK1C2_HUMAN
91 PsiBlast_CBE 82.1132% -96 - C7 -4JQ4 12.6 AK1C2_HUMAN
40 PsiBlast_CBE 80.6836%-101 - C7 -3H7R 10.2 AKRC8_ARATH
41 PsiBlast_CBE 79.3637% -84 - C7 -3H7U 10.3 AKRC9_ARATH