@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2830: (2016-04-07 )
MAIIFAKEDDLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLVDGEIKGAIAGIVSCDELRSRFKSLAK

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MPD_B_5(2EIQ)
THIO_ECOLI
[Raw transfer]




EDO_B_4(4BA7)
?
[Raw transfer]




MPD_A_5(2TRX)
THIO_ECOLI
[Raw transfer]




MPD_B_8(2TRX)
THIO_ECOLI
[Raw transfer]




MPD_A_11(2TRX)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H70)
THIO_ECOLI
[Raw transfer]




MPD_G_11(2FCH)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H72)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H71)
THIO_ECOLI
[Raw transfer]




MPD_B_4(2H75)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H6Y)
THIO_ECOLI
[Raw transfer]




MPD_B_5(2H70)
THIO_ECOLI
[Raw transfer]




100 Fugue 92.7431%-162 - C2 -2TRX - THIO_ECOLI -
23 PsiBlast_CBE 89.9734%-133 - C2 -2H70 2.6 THIO_ECOLI
25 PsiBlast_CBE 89.7233%-142 - C2 -3TCO - ? -
33 PsiBlast_CBE 88.3533%-129 - C2 -4BA7 Error ?
2 PsiBlast_PDB 88.2934%-129 - C2 -2H71 2.8 THIO_ECOLI
4 PsiBlast_PDB 88.2734%-127 - C2 -2H75 - THIO_ECOLI -
10 PsiBlast_PDB 87.8432%-137 - C2 -1SKR - THIO_ECOLI -
57 PsiBlast_CBE 87.7231%-143 - C2 -1KEB - THIO_ECOLI -
112 HHSearch 87.5533%-125 - C2 -2E0Q - ? -
22 PsiBlast_CBE 87.5234%-134 - C2 -2H75 2.7 THIO_ECOLI
41 PsiBlast_CBE 87.5032%-131 - C2 -2H6Z - THIO_ECOLI -
20 PsiBlast_PDB 87.4532%-134 - C2 -1T8E - THIO_ECOLI -
27 PsiBlast_CBE 87.2232%-133 - C2 -2TRX 2.7 THIO_ECOLI
3 PsiBlast_PDB 87.1934%-124 - C2 -2H73 - THIO_ECOLI -
15 PsiBlast_PDB 87.1632%-139 - C2 -1SL2 - THIO_ECOLI -
26 PsiBlast_CBE 87.0933%-140 - C2 -3TCO - ? -
116 HHSearch 87.0730%-128 - C2 -2O8V - THIO_ECOLI -
36 PsiBlast_CBE 87.0732%-135 - C2 -3DXB - PUF60_HUMAN (first) -
8 PsiBlast_PDB 87.0032%-132 - C2 -2TRX 2.9 THIO_ECOLI
58 PsiBlast_CBE 86.9331%-146 - C2 -1KEB - THIO_ECOLI -
1 PsiBlast_PDB 86.7034%-131 - C2 -2H70 2.8 THIO_ECOLI
32 PsiBlast_CBE 85.5132%-121 - C2 -2H6Y 2.8 THIO_ECOLI
44 PsiBlast_CBE 84.9832%-130 - C2 -2EIQ Error THIO_ECOLI
51 PsiBlast_CBE 84.9431%-130 - C2 -2FCH 3.0 THIO_ECOLI
47 PsiBlast_CBE 83.8431%-128 - C2 -2H72 3.0 THIO_ECOLI