@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0137: (2015-11-28 )
MSVLEIKNLHVSIEDKEILKGLNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPNYEVTAGEILFDGEDILELEVDERARLGLFLAMQYPSEVPGITNAEFIRAAMNAGKADDDKISIRQFITKLDEKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPKFALLDEIDSGLDIDALKVVSKGVNEMRGEGFGAMIITHYQRLLNYITPDKVHVMMDGKVVLSGGPELAVRLEKEGYAQIAEELGLEYKEEV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_4(2D2F)
?
[Raw transfer]




MES_C_5(2ZU0)
SUFC_ECOLI
[Raw transfer]




1 PsiBlast_PDB 95.4562%-113 - C1 -2D2E - ? -
58 HHSearch 94.5963%-112 - C1 -2D2E - ? -
2 PsiBlast_PDB 94.5562%-110 - C1 -2D2F 5.6 ?
4 PsiBlast_PDB 86.3151% -92 - C1 -2ZU0 1.9 SUFC_ECOLI
3 PsiBlast_PDB 82.6651% -97 - C1 -2D3W - SUFC_ECOLI -
5 PsiBlast_PDB 66.9932% -90 - C1 -4WBS - ? -
21 PsiBlast_CBE 65.3032% -86 - C1 -4WBS - ? -
46 HHSearch 64.8729% -88 - C1 -2IT1 - ? -
72 Fugue 63.5025% -74 - C1 -1OXS - ? -
47 HHSearch 62.5625% -97 - C1 -1V43 - ? -
62 HHSearch 62.3926% -82 - C1 -2OLJ - ? -
6 PsiBlast_PDB 62.3529% -68 - C1 -4F4C - PGP1_CAEEL -
74 Fugue 62.0120% -66 - C1 -1Z47 - ? -
24 PsiBlast_CBE 61.4131% -83 - C1 -4M1M - MDR1A_MOUSE -
53 HHSearch 61.2724% -81 - C1 -1OXX - ? -
75 Fugue 61.1622% -80 - C1 -3TUZ - METN_ECOLI -
13 PsiBlast_PDB 60.9431% -86 - C1 -4Q9H - MDR1A_MOUSE -
49 HHSearch 60.5024% -88 - C1 -2YYZ - ? -
63 HHSearch 60.3629% -83 - C1 -3GFO - ECFA3_CLOP1 -
16 PsiBlast_PDB 60.1731% -86 - C1 -4Q9K - MDR1A_MOUSE -