@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0149: (2015-11-28 )
MRIFEKAPAKLNLGLDIKGRCDDGYHELAMIMVSIDLNDYVTISELKEDCIVIDSDSSKMPLNNDNDVFKAADIIKNQYGINKGVHIRLEKSIPVCAGLGGGSTDAAATIRALNRLWNLQMDYDEMVAIGFKIGSDVPYCLGGGCSLVLGKGEIVKPLPTLRPCWIVLVKPDFGISTKSIFRDIDCKSISRVDIDLLKSAILSSDYQLMVKSMGNSLEDITITKNPVISTIKERMLNSGADVALMTGSGPTVFSMCSTEKKADRVFNSMKGFCKEVYKVRLLR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_2(4ED4)
?
[Raw transfer]



ATP_A_3(4DXL)
?
[Raw transfer]



ADP_A_2(3PYG)
ISPE_MYCTU
[Raw transfer]
3 PsiBlast_PDB 95.2229% -89 - C1 -4EMD - ? -
1 PsiBlast_PDB 92.6329% -87 - C1 -4DXL 6.2 ?
2 PsiBlast_PDB 92.0129% -90 - C1 -4ED4 6.6 ?
7 PsiBlast_PDB 90.2928% -92 - C1 -3PYG 3.7 ISPE_MYCTU
4 PsiBlast_PDB 90.2728% -95 - C1 -3PYD - ISPE_MYCTU -
5 PsiBlast_PDB 89.1928% -92 - C1 -3PYE - ISPE_MYCTU -
6 PsiBlast_PDB 88.4028% -92 - C1 -3PYF - ISPE_MYCTU -
44 Fugue 87.1031% -89 - C1 -1UEK - ISPE_THET8 -
22 HHSearch 84.3629% -92 - C1 -1UEK - ISPE_THET8 -
21 HHSearch 82.1427% -82 - C1 -3PYF - ISPE_MYCTU -
24 HHSearch 80.9830% -83 - C1 -2WW4 - ISPE_ECOLI -
9 PsiBlast_PDB 80.0528% -89 - C1 -2WW4 - ISPE_ECOLI -
10 PsiBlast_PDB 79.9928% -87 - C1 -1OJ4 - ISPE_ECOL6 -
8 PsiBlast_PDB 78.0132% -88 - C1 -1UEK - ISPE_THET8 -
28 HHSearch 76.0122% -92 - C1 -1H72 - KHSE_METJA -
48 Fugue 75.7922% -97 - C1 -1H74 - KHSE_METJA -
49 Fugue 75.7622%-102 * C1 *1H72 - KHSE_METJA -
47 Fugue 74.6621% -91 - C1 -1H72 - KHSE_METJA -
14 PsiBlast_PDB 74.5229% -78 - C1 -2V34 - ISPE_AQUAE -
16 PsiBlast_PDB 74.0729% -78 - C1 -2VF3 - ISPE_AQUAE -