@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu07450: (2016-06-11 )
MTASQQQIQLARRPQGIPVHEDFRFETIPVPEPKQGEVLVKTLYVSVDPYMRGRMQDTKSYVEPFALDKALSGGVIAEVVSDGNHLKKGDIVIGNLSWQEFSAVSESALRKIDTSLAPASAYLGILGMTGLTAYFGLLDIGRPKEGETVVVSGAAGAVGSTVGQIAKIKGARVVGIAGSDEKIDYLKQELQFDEAINYKTADDIQKALQNACPDGVDVYFDNVGGPISDAVMNLLNEFARIPVCGAISSYNAESEADDMGPRVQSKLIKTKSLMQGFIVSDYSDRFSEGAKQLAEWLKAGKLHYEETITEGFENIPDAFLGLFKGENKGKQLIKVSDPS

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_3(4HFM)
DBR_TOBAC
[Raw transfer]




NAP_A_9(1V3V)
PTGR1_CAVPO
[Raw transfer]




NAP_A_3(2J3K)
P1_ARATH
[Raw transfer]




NAP_D_4(1V3T)
PTGR1_CAVPO
[Raw transfer]




NAP_A_3(4WGG)
?
[Raw transfer]




NAP_A_3(4NH4)
?
[Raw transfer]




NAP_B_5(2J3J)
P1_ARATH
[Raw transfer]




NAP_C_3(1V3T)
PTGR1_CAVPO
[Raw transfer]




NAP_A_3(4NH4)
?
[Raw transfer]




NAP_A_3(4HFM)
DBR_TOBAC
[Raw transfer]




NAP_A_3(2DM6)
PTGR1_CAVPO
[Raw transfer]




NAP_A_2(2VNA)
PTGR2_HUMAN
[Raw transfer]




NDP_A_2(2ZB3)
PTGR2_MOUSE
[Raw transfer]




NAP_A_4(2ZB8)
PTGR2_HUMAN
[Raw transfer]




NAP_A_3(4HFN)
DBR_TOBAC
[Raw transfer]




NAP_A_6(2ZB4)
PTGR2_HUMAN
[Raw transfer]




NAP_B_4(2DM6)
PTGR1_CAVPO
[Raw transfer]




NAP_B_4(4NH4)
?
[Raw transfer]




NAP_B_10(1V3V)
PTGR1_CAVPO
[Raw transfer]




NAP_B_5(4WGG)
?
[Raw transfer]




NDP_A_2(2ZB7)
PTGR2_HUMAN
[Raw transfer]




NAP_A_2(2W4Q)
PTGR2_HUMAN
[Raw transfer]




NAP_B_10(2W98)
PTGR2_HUMAN
[Raw transfer]




NAP_A_3(2J3I)
P1_ARATH
[Raw transfer]




NAP_A_5(2Y05)
PTGR1_HUMAN
[Raw transfer]




NAP_B_5(2J3K)
P1_ARATH
[Raw transfer]




NAP_A_3(2J3J)
P1_ARATH
[Raw transfer]




CBW_A_3(2W4Q)
PTGR2_HUMAN
[Raw transfer]




CIY_A_4(4WGG)
?
[Raw transfer]




IMN_A_5(2ZB8)
PTGR2_HUMAN
[Raw transfer]




HC4_B_6(2J3J)
P1_ARATH
[Raw transfer]




HC4_A_4(2J3J)
P1_ARATH
[Raw transfer]




5OP_B_12(1V3V)
PTGR1_CAVPO
[Raw transfer]




CIY_A_4(4HFN)
DBR_TOBAC
[Raw transfer]




5OP_A_11(1V3V)
PTGR1_CAVPO
[Raw transfer]




HNE_B_6(2J3K)
P1_ARATH
[Raw transfer]




NCA_A_3(2ZB7)
PTGR2_HUMAN
[Raw transfer]




IMN_A_5(2DM6)
PTGR1_CAVPO
[Raw transfer]




HNE_A_4(2J3K)
P1_ARATH
[Raw transfer]




NAP_B_4(2J3I)
P1_ARATH
[Raw transfer]




32 PsiBlast_CBE 85.7248%-102 - C2 -4B7C - ? -
35 PsiBlast_CBE 84.8548%-102 - C2 -4B7C - ? -
34 PsiBlast_CBE 84.8148%-101 - C2 -4B7C - ? -
17 PsiBlast_PDB 84.2842% -97 - C2 -2W4Q 10.3 PTGR2_HUMAN
21 PsiBlast_CBE 84.1748%-100 - C2 -4B7X - ? -
23 PsiBlast_CBE 83.9348%-100 - C2 -4B7X - ? -
25 PsiBlast_CBE 83.9248% -99 - C2 -4B7X - ? -
36 PsiBlast_CBE 83.7548%-104 - C2 -4B7C - ? -
30 PsiBlast_CBE 83.6748%-100 - C2 -4B7X - ? -
31 PsiBlast_CBE 83.6248% -94 - C2 -4B7X - ? -
2 PsiBlast_PDB 83.6148% -93 - C2 -4B7X - ? -
54 PsiBlast_CBE 83.3842%-101 - C2 -2ZB8 11.1 PTGR2_HUMAN
1 PsiBlast_PDB 83.2548%-101 - C2 -4B7C - ? -
53 PsiBlast_CBE 83.1342%-100 - C2 -2W98 11.0 PTGR2_HUMAN
33 PsiBlast_CBE 82.6148%-106 - C2 -4B7C - ? -
26 PsiBlast_CBE 82.5548%-103 - C2 -4B7X - ? -
11 PsiBlast_PDB 82.2443%-108 - C2 -4WGG 10.3 ?
27 PsiBlast_CBE 82.0648% -93 - C2 -4B7X - ? -
19 PsiBlast_PDB 82.0042%-102 - C2 -2ZB4 11.0 PTGR2_HUMAN
28 PsiBlast_CBE 81.9848% -96 - C2 -4B7X - ? -
42 PsiBlast_CBE 81.6943%-112 - C2 -4WGG 9.1 ?
18 PsiBlast_PDB 81.4842%-102 - C2 -2VNA 9.9 PTGR2_HUMAN
20 PsiBlast_PDB 80.6942% -98 - C2 -2ZB7 11.1 PTGR2_HUMAN
10 PsiBlast_PDB 80.4343%-106 - C2 -4NH4 10.7 ?
41 PsiBlast_CBE 79.3743%-108 - C2 -4NH4 9.9 ?
39 PsiBlast_CBE 79.0541%-105 - C2 -2J3I 3.6 P1_ARATH
37 PsiBlast_CBE 78.9541%-103 - C2 -2J3K 8.9 P1_ARATH
12 PsiBlast_PDB 78.7843%-100 - C2 -1V3T 10.2 PTGR1_CAVPO
38 PsiBlast_CBE 78.3141% -99 - C2 -2J3J 10.1 P1_ARATH
44 PsiBlast_CBE 78.2043% -96 - C2 -1V3V 10.6 PTGR1_CAVPO
43 PsiBlast_CBE 78.1843%-100 - C2 -2DM6 11.0 PTGR1_CAVPO
55 PsiBlast_CBE 77.7542% -99 - C2 -2ZB3 10.3 PTGR2_MOUSE
14 PsiBlast_PDB 77.3343%-102 - C2 -2DM6 11.0 PTGR1_CAVPO
13 PsiBlast_PDB 77.0043%-100 - C2 -1V3V 10.3 PTGR1_CAVPO
9 PsiBlast_PDB 76.9043% -99 - C2 -4HFN 10.7 DBR_TOBAC
8 PsiBlast_PDB 76.8843% -98 - C2 -4HFM 11.3 DBR_TOBAC
6 PsiBlast_PDB 76.5841% -98 - C2 -2J3K 9.1 P1_ARATH
5 PsiBlast_PDB 76.5541% -98 - C2 -2J3J 10.4 P1_ARATH
46 PsiBlast_CBE 76.4943% -98 - C2 -1V3T 10.7 PTGR1_CAVPO
4 PsiBlast_PDB 76.0941%-101 - C2 -2J3I 8.6 P1_ARATH
100 HHSearch 75.6243% -98 * C2 *4HFM 11.3 DBR_TOBAC
106 HHSearch 75.2542% -94 - C2 -4NH4 10.7 ?
15 PsiBlast_PDB 74.6243% -98 - C2 -2Y05 10.6 PTGR1_HUMAN