@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0149: (2016-04-19 )
MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLLLTKGEYQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANVVRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQAGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDDALGVLAIDGKLLLIGFAAGAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGLNQLVFLGLRPPPPQRYPLSEAQAALQSLDDGGVLGKVVLEP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MPD_B_15(4EYE)
?
[Raw transfer]




MPD_A_3(4EYE)
?
[Raw transfer]




21 PsiBlast_CBE 97.5760%-128 - C1 -4EYE 2.9 ?
1 PsiBlast_PDB 96.9560%-126 - C1 -4EYE - ? -
38 HHSearch 95.5660%-126 - C1 -4EYE 3.0 ?
36 HHSearch 78.2631%-116 - C1 -2EIH - ? -
2 PsiBlast_PDB 77.5738%-122 - C1 -1IYZ - ? -
39 HHSearch 75.9032%-116 * C1 *4RVU - ? -
6 PsiBlast_PDB 75.0528%-114 - C1 -2EIH - ? -
7 PsiBlast_PDB 74.8928%-119 - C1 -1YB5 - QOR_HUMAN -
43 HHSearch 74.8827%-115 - C1 -3JYN - ? -
4 PsiBlast_PDB 74.7632%-117 - C1 -4RVU - ? -
45 HHSearch 74.0427%-126 - C1 -3S2E - ? -
23 PsiBlast_CBE 73.9332%-119 - C1 -4RVU - ? -
3 PsiBlast_PDB 73.8732%-124 - C1 -4RVS - ? -
41 HHSearch 73.4928%-113 - C1 -1YB5 - QOR_HUMAN -
22 PsiBlast_CBE 73.1932%-122 - C1 -4RVU - ? -
51 HHSearch 72.7931%-121 - C1 -4J6F - ? -
10 PsiBlast_PDB 72.7231%-119 - C1 -1WLY - CAA43_BURSP -
34 HHSearch 71.1930%-118 - C1 -1JVB - ADH_SULSO -
35 HHSearch 70.2823%-108 - C1 -3KRT - ? -
47 HHSearch 68.9030%-108 - C1 -3UOG - ? -