@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0632c: (2016-04-24 )
MSDPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDDVGALVITGNGRVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHAIAMGAFLLSCGDHRVAAHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKTFFGETALAAGFIDEIALPEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGIDGIAAEFGL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CAA_A_2(4FN8)
?
[Raw transfer]




3HC_A_3(4FNB)
?
[Raw transfer]




3H9_A_2(4FND)
?
[Raw transfer]




MRD_A_3(3OT6)
?
[Raw transfer]




105 HHSearch 99.06100%-126 - C2 -4FN7 - ? -
4 PsiBlast_PDB 99.06100%-126 - C2 -4FN7 - ? -
21 PsiBlast_CBE 98.71100%-127 - C2 -4FN7 - ? -
2 PsiBlast_PDB 98.67100%-126 - C2 -4FNB 6.7 ?
1 PsiBlast_PDB 98.25100%-127 - C2 -4FN8 8.4 ?
3 PsiBlast_PDB 97.99100%-126 - C2 -4FND 6.5 ?
5 PsiBlast_PDB 96.7796%-128 - C2 -4HC8 - ? -
22 PsiBlast_CBE 95.77100%-129 - C2 -4FN7 - ? -
6 PsiBlast_PDB 93.7984%-130 - C2 -3R6H - ? -
7 PsiBlast_PDB 74.2939%-116 - C2 -3OT6 3.9 ?
109 HHSearch 65.5522%-110 - C2 -3PEA - ? -
9 PsiBlast_PDB 65.2731%-110 - C2 -3HRX - ? -
12 PsiBlast_PDB 65.1125%-122 - C2 -3PEA - ? -
106 HHSearch 64.3726%-112 - C2 -3HRX - ? -
113 HHSearch 63.2517%-111 - C2 -2FBM - CDY1_HUMAN -
27 PsiBlast_CBE 63.1833%-102 - C2 -3TRR - ? -
100 HHSearch 63.0822%-101 - C2 -4FZW - PAAG_ECOLI -
24 PsiBlast_CBE 62.7733%-102 - C2 -3TRR - ? -
10 PsiBlast_PDB 62.5433%-102 - C2 -3TRR - ? -
26 PsiBlast_CBE 62.3133%-102 - C2 -3TRR - ? -