@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1738: (2016-05-04 )
MCGDQSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_3(4WPY)
Y1738_MYCTU
[Raw transfer]



GOL_A_3(4WPY)
Y1738_MYCTU
[Raw transfer]
8 HHSearch 97.98100% -71 - C2 -4WPY 3.4 Y1738_MYCTU
2 PsiBlast_PDB 96.17100% -69 - C2 -4WPY 3.4 Y1738_MYCTU
1 PsiBlast_PDB 91.77100% -65 - C2 -4WSP - Y1738_MYCTU -
3 PsiBlast_PDB 63.5355% -12 - C2 -2FGG - Y2632_MYCTU -
18 Fugue 63.4056% -12 - C2 -2FGG - Y2632_MYCTU -
9 HHSearch 63.1453% -12 - C2 -2FGG - Y2632_MYCTU -
27 Fugue 55.1118% -17 - C3 -2GRG - YN034_YEAST -
25 Fugue 54.8116% -64 - C3 -1GRJ - ? -
26 Fugue 49.9014% -22 - C2 -1WWV - CNKR1_HUMAN -
11 HHSearch 47.2013% -23 - C2 -2RQL - HPF_ECOLI -
24 Fugue 46.8423% -9 - C2 -3GNA - -
10 HHSearch 46.6115% -21 - C2 -4HEI - ? -
22 Fugue 46.0712% -32 * C3 *2L1T - ? -
5 PsiBlast_PDB 44.2926% -27 - C2 -1IZM - Y817_HAEIN -
12 HHSearch 44.229% -23 - C2 -3TQM - ? -
16 HHSearch 42.907% -9 - C2 -1IMU - RAIA_HAEIN -
6 PsiBlast_PDB 42.4829% -37 - C2 -5CNQ - ? -
4 PsiBlast_PDB 41.9428% -29 - C2 -5CO8 - ? -
23 Fugue 41.1422% -31 - C3 -1IHV - POL_HV1Z6 -
19 Fugue 41.0721% -14 - C1 -2AN7 - PARD_ECOLX -