@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA2602: (2016-02-09 )
MSSILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKENPA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OXY_A_3(4QMA)
?
[Raw transfer]




2 PsiBlast_PDB 98.35100%-116 - C3 -4TLF - ? -
23 PsiBlast_CBE 98.06100%-115 * C3 *4TLF - ? -
22 PsiBlast_CBE 97.97100%-110 - C3 -4TLF - ? -
21 PsiBlast_CBE 96.57100%-108 - C3 -4TLF - ? -
45 Fugue 96.42100%-116 - C3 -3USS - ? -
1 PsiBlast_PDB 96.35100%-116 - C3 -3USS - ? -
24 PsiBlast_CBE 95.87100%-110 - C3 -3USS - ? -
3 PsiBlast_PDB 87.1163%-106 - C3 -4QMA 3.2 ?
5 PsiBlast_PDB 49.8323% -67 - C3 -4UBG - CDO1_RAT -
15 PsiBlast_PDB 49.2724% -70 - C3 -4IET - CDO1_RAT -
11 PsiBlast_PDB 48.8924% -67 - C3 -4IEP - CDO1_RAT -
17 PsiBlast_PDB 48.5924% -66 - C3 -4IEV - CDO1_RAT -
19 PsiBlast_PDB 48.4324% -76 - C3 -4IEX - CDO1_RAT -
16 PsiBlast_PDB 48.4124% -67 - C3 -4IEU - CDO1_RAT -
9 PsiBlast_PDB 48.1024% -67 - C3 -3ELN - CDO1_RAT -
20 PsiBlast_PDB 48.0724% -72 - C3 -4IEY - CDO1_RAT -
14 PsiBlast_PDB 47.8524% -68 - C3 -4IES - CDO1_RAT -
12 PsiBlast_PDB 47.5924% -67 - C3 -4IEQ - CDO1_RAT -
47 Fugue 47.4917% -54 - C3 -2ATF - CDO1_MOUSE -
10 PsiBlast_PDB 47.4424% -67 - C3 -4IEO - CDO1_RAT -