@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VPX2: (2017-11-23 )
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNHISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHIDSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDACKGIDLNGSLEQAWQTMQQQGVIRIQSTDLLNEC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NIO_B_11(2WT9)
?
[Raw transfer]




NIO_B_11(2WT9)
?
[Raw transfer]




NIO_A_6(2WT9)
?
[Raw transfer]




VGL_A_3(2WTA)
?
[Raw transfer]




VGL_A_3(2WTA)
?
[Raw transfer]




NIO_A_6(3R2J)
?
[Raw transfer]




NIO_A_6(3R2J)
?
[Raw transfer]




NIO_B_8(3R2J)
?
[Raw transfer]




NIO_D_13(3R2J)
?
[Raw transfer]




NIO_C_11(3R2J)
?
[Raw transfer]




NIO_B_8(3R2J)
?
[Raw transfer]




66 HHSearch 94.33100%-127 - C5 -2WTA 2.3 ?
2 PsiBlast_PDB 94.0799%-127 - C5 -2WTA 2.3 ?
67 HHSearch 92.89100%-122 - C5 -2WT9 2.7 ?
21 PsiBlast_CBE 92.6399%-122 - C5 -2WT9 2.7 ?
1 PsiBlast_PDB 92.1599%-124 - C5 -2WT9 2.4 ?
75 HHSearch 59.4736% -31 - C5 -3R2J 3.1 ?
74 HHSearch 57.8636% -24 - C5 -3R2J 3.1 ?
22 PsiBlast_CBE 55.9636% -24 - C5 -3R2J 3.2 ?
23 PsiBlast_CBE 55.7836% -18 - C5 -3R2J 3.4 ?
24 PsiBlast_CBE 55.1636% -27 - C5 -3R2J 3.1 ?
5 PsiBlast_PDB 55.1536% -19 - C5 -3R2J 3.1 ?
3 PsiBlast_PDB 55.0238% -8 - C5 -1IM5 - ? -
81 HHSearch 54.5343% -13 - C5 -1IM5 - ? -
4 PsiBlast_PDB 53.8938% -13 - C5 -1ILW - ? -
7 PsiBlast_PDB 53.0136% -32 - C5 -3PL1 - PNCA_MYCTU -
73 HHSearch 52.2132% 15 - C5 -2H0R - PNC1_YEAST -
10 PsiBlast_PDB 51.0328%-135 - C5 -3EEF - ? -
58 Fugue 50.6620% -36 - C5 -1YAC - YCAC_ECOLI -
56 Fugue 50.4532% 30 - C5 -2H0R - PNC1_YEAST -
6 PsiBlast_PDB 50.2135% 21 - C5 -2H0R - PNC1_YEAST -