@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ACKR1_HUMAN: (2016-01-08 )
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

Atome Classification :

(20 SA) ------------.........10........20........30.---..-----.....40........50........60........70........80....---.-------...90.-....--------------------..-.100.......-110-.--.......120-.....----..-..130.......140------.......150------.-------.--.....------.160------......---------.170.......180..------------.....190---.-------.-----....------...200---------..-...-...-----210.-----...-...220.....------.---.230..-------------------.---------------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------------...----240......----.250..----.....260....---------...270-........280.......290-------..----.....300.....----------------..310...--....320.......330....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ------------MGNCLHRAELSPSTENSSQLDFEDVWNSSYGV---ND-----SFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFR---P-------LFRWQL-CPGW--------------------PV-LAQLAVGSALF-S-I-V--VPVLAPGL---GSTRS----SA-LCSLGYCVWYGSAFA------QALLLGCHA-------S-------L--GHRLG------AGQV------PGLTLG---------LTVGIWGVAALLTLPV------------TLASGA-----S-------G-----GLCT------LIYST----------EL-KAL-QAT-----HTVA-----CLA-IFVLLPLGLFG------A---KGLKKA-------------------L---------------------------------------------------------------------------------------------------------------------------------------------------------------------------G----------------MGP----GPWMNILWA----WFIFWW----PHGVVLGLDFLV---------RSKLL--LLSTCLAQQALDLLLNLAEAL-------AI----LHCVATPLLLALF----------------CHQATRTL--LPSLPLPEGWSSHLDTLGSKS
41 Fugue 87.3718%-127 - C7 -4XNV P2RY1_HUMAN (first) A:[38-382] ------------SFKCALTKT-----------------------------------------------------GFQFYYLPAVYILVFIIGFLGNSVAIWMFVF---H-------MKPW----SGI--------------------SVYMFNLALADFLY-V-L-T--LPALIFYY---FNKTDWIFGDA-MCKLQRFIFHVNLYG------SILFLTCIS-------A-------H--RYSGVVYPKSLGRLK------KKNAIC---------ISVLVWLIVVVAISPI------------LFYSGT-----GVRKNK--T-----ITCYDTTSDEYLRSY----------FI-YSM-CTT-----VAMF-----CVP-LVLILGCYGLI------V---RALIYK-------------------M---------------------------------------------------------------------------------------------------------------------------------------------------------------------------K----------------KYT----CTVCGYIYN----PEDGDP----DNGVNPGTDFKDIVCPLCGVGKDQFE--EVEEPLRRKSIYLVIIVLTVF-------AVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVNPILYFLAGDTFRRR-
5 PsiBlast_PDB 86.2723%-152 - C7 -4XT3 US28_HCMVA A:[26-298] -----------------------------------------------------------------EDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFT---I-------TWRRRIQCSGD--------------------VY-FINLAAADLLF-V-C-T--LPLWMQYL---LDH--A---SV-PCTLLTACFYVAMFASLCFITEIALDRYYA-------I-------V--YMRYR------PVKQ------ACL------------FSIFWWIFAVIIAIPH------------FMVVTK-----K-------D-----NQCM----------T----------DY-DYL-EVS-----YPIILNVELMLG-AFVI-PLSVISYCYYRIS---RIVAVS-------------------Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------RHK----GRIVRVLIAVVLVFIIFWL----PYHLTLFVDTL------------KLLKWISSSCEFERSLKRALILTESL-------AF----CHCCLNPLLYVFV----------------GTKFRQEL--HCLLAE---------------
47 Fugue 85.3917%-127 - C4 -4K90 ELM_ASPFU A:[1-389] ADYQVYAWGINDPTEGERTVIKDPWDSVASEFTWISDGSTNYTT---SRGNNGIAQSNPSGGPSYLNNYRPSSSSLSFKYPYSVSSSPPSSYIDASIIQLFYTAN---I-------YHDLLY-TLGFTEKAGNFEYNTNGQGGLGNDYV-ILNAQDGSGTN-N-A-N--FATPPDGQ---PGRMR----MY-VWTESTPYRDGSFEA------GIVIHEYTH-------G-------L--SNRLT------GGPANSNCLNALESGG---------MGEGWSDFMATAIRLKPGDKRSTDYTMGEWASNR-----A-------G-----GIRQ------YPYSTSLSTNPLTYTSV-NSL-NAV-----HAIG-----TVW-ASMLYEVLW-------------NLIDK-------------------H---------------------------------------------------------------------------------------------------------------------------------------------------------------------------G----------------KND----APKPTLRDG----VP--------TDGKYLAMKLVM---------DGMAL--QPCNPNFVQARDAILDADTALTGGENQCEI----WTAFAK-RGLGAG----------------AKYSSRNR--VGSTEVPSGVC----------
31 HHSearch 82.9420%-149 - C7 -2LNL - CXCR1_HUMAN A:[38-322] ----------------------------------------------------------------------------NKYVVIIAYALVFLLSLLGNSLVMLVILY---S---------RVGR-SVTD--------------------VY-LLNLALADLLF-A-L-T--LPIWAASKVN-GWIFG----TF-LCKVVSLLKEVNFYS------GILLLACISVDRYLAIV-------H--ATRTL------T-QK------RHLVKF---------VCLGCWGLSMNLSLPF------------FLFRQA-----Y-------HPNNSSPVCY------EVLGN----------DT-AKW-RMV-----LRIL-----PHT-FGFIVPLFVML------FCYGFTLRTLFKAHMGQ------------K---------------------------------------------------------------------------------------------------------------------------------------------------------------------------H----------------RAM----RVIFAVVLI----FLLCWL----PYNLVLLADTLM---------RTQVI---QESCERRNNIGRALDATEIL-------GF----LHSCLNPIIYAFI----------------GQNFRHGF--LKILAMHG-------------
4 PsiBlast_PDB 80.8923%-153 - C7 -4XT1 US28_HCMVA A:[23-298] -----------------------------------------------------------DYD---EDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFT---I-------TWRRRIQCSGD--------------------VY-FINLAAADLLF-V-C-T--LPLWMQYL---LD-------SV-PCTLLTACFYVAMFASLCFITEIALDRYYA-------I-------V--YMRYR------PVKQ------ACL------------FSIFWWIFAVIIAIPH------------FMVVTK-----K-------D-----NQCM----------T----------DY-DYL-EVS-----YPIILNVELMLG-AFVI-PLSVISYCYYRIS---RIVAVS-------------------Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------RHK----GRIVRVLIAVVLVFIIFWL----PYHLTLFVDTL------------KLLKWISSSCEFERSLKRALILTESL-------AF----CHCCLNPLLYVFV----------------GTKFRQEL--HCLLAEFR-------------
24 HHSearch 80.5116%-153 - C7 -3ODU CXCR4_HUMAN (first) A:[44-497] -------------------------------------------------------------------------ANFNKIFLPTIYSIIFLTGIVGNGLVILVMGY---Q---------KKLR-SMTD--------------------KY-RLHLSVADLLF-V-I-T--LPFWAVDAVA-NWYFG----NF-LCKAVHVIYTVNLYS------SVWILAFISLDRYLAIV-------H--ATNSQ------RPRK------LLAEKV---------VYVGVWIPALLLTIPD------------FIFANV-----SEADD---R-----YICD------RFYPN----------D---LW-VVV-----FQFQ-----HIM-VGLILPGIVIL------SCYCIIISKL-------------------SHSGSNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSKGHQKR----------------KAL----KTTVILILA----FFACWL----PYYIGISIDSFI---------LLEII---KQGCEFENTVHKWISITEAL-------AF----FHCCLNPILYAFL----------------GAKFKTSA--QHALTSGRPLEVLFQ------
34 HHSearch 77.9015%-151 - C7 -3V2Y ENLYS_BPT4 A:[60-495] --------------------------------------------------------------------------ENSIKLTSVVFILICCFIILENIFVLLTIWK---T---------KKFH-RPMY--------------------YF-IGNLALSDLLA-G-VAY--TANLLLSGAT-TYKLT----PA-QWFLREGSMFVALSA------SVFSLLAIA-------IERYITMLK----------------N------NFRLFL---------LISACWVISLILGGLP------------IMGWNC-----ISA-----L-----SSCS------TVLPL----------YH------KH-----YIL------FCT-TVFTLLLLSIV------ILYCRIYSLV-------------------RTRNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYASRSSEN--V----------------ALL----KTVIIVLSV----FIACWA----PLFILLLLDVGC---------KVKT-----------CDILFRAEYFLVL-------AV----LNSGTNPIIYTLT----------------NKEMRRAF--IRIMGRPL-------------
25 HHSearch 77.0614%-149 - C7 -3UON ACM2_HUMAN (first) A:[24-457] ------------------------------------------------------------------------------VFIVLVAGSLSLVTIIGNILVMVSIKV---N---------RHLQ-TVNN--------------------YF-LFSLACADLIIGV-F-S--MNLYTLYTVIGYWPLG----PV-VCDLWLALDYVVSNA------SVMNLLIIS-------FDRYFCVTK--PLTYP------VKRT------TKMAGM---------MIAAAWVLSFILWAPA------------ILFWQF-----IVGVRTVED-----GECY------IQFFS-----------------NAA-----VTFG-----TAI-AAFYLPVIIMT------VLYWHISRAS-------------------KSRINIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYPPPSRE--K----------------KVT----RTILAILLA----FIITWA----PYNVMVLINTFC---------APC-------------IPNTVWTIGYWL-------CY----INSTINPACYALC----------------NATFKKTF--KHLLM----------------
36 HHSearch 74.8012%-145 - C7 -2Z73 OPSD_TODPA A:[32-332] ---------------------------------------------------------------------------AVYYSLGIFIGICGIIGCGGNGIVIYLFTK---T---------KSLQ-TPAN--------------------MF-IINLAFSDFTF-S-L-VNGFPLMTISCFLKKWIFG----FA-ACKVYGFIGGIFGFM------SIMTMAMIS-------IDRYNVIGR--PMAAS------KKMS------HRRAFI---------MIIFVWLWSVLWAIGP------------IFGWGA-----YTLEGV--L-----CNCS------FDYIS----------RD-STT--RS-----NILC-----MFI-LGFFGPILIIF------FCYFNIVMSV-------------------SNHEKEMAAMAKRLNAKELRKAQAGANAE-----------------------------------------------------------------------------------------------------------------------------------------------M----------------RLA----KISIVIVSQ----FLLSWS----PYAVVALLAQFG---------PLE------------WVTPYAAQLPVMF-------AK----ASAIHNPMIYSVS----------------HPKFREAI--SQTFPWVLTCCQFDDKETEDD
50 Fugue 73.6418%-125 - C6 -4ART Y273_ATV A:[22-270] ------------IDATNDEEKLADIVENEIEKEIRKIENFYYYILRDGK-----IYPASDYDIEVEKGKR-------SANDIYAFVETDVTR-------DFDEFL---F-------DIDYGL--PSI--------------------SD-ILKFYLEKAGF-R-I-A--NEVPTP-------------------NLKYYIHAVVEFP------QYLAVNIYD----------------------------------------------------------IDSLARALRIPQ------------IVEQKL-------------G-----NKPR------TITAD----------EF-NDI-ERI-----VAEE-------------QPI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LAG----YTYDEALRI----PYHYYV----DH----------------------------NNSFKDDALKIAHAYLQLF-------P----------TP---YQV----------------CYEWKARW--FNKID-----CLKLERLK---
35 HHSearch 69.4113%-134 - C7 -1U19 OPSD_BOVIN A:[38-328] ---------------------------------------------------------------------------WQFSMLAAYMFLLIMLGFPINFLTLYVTVQ---H---------KKLR-TPLN--------------------YI-LLNLAVADLFM-VFG-G--FTTTLYTSLHGYFVFG----PT-GCNLEGFFATLGGEI------ALWSLVVLAIERYVVVC-------K--PMSNF------R-FG------ENHAIM---------GVAFTWVMALACAAPP------------LVGWSR-----YIPE----GMQ---CSCG------IDYYT----------PHEETN-NES-----FVIY-----MFV-VHFIIPLIVIF------FCYGQLVFTV-------------------K---------------------------------------------------------------------------------------------------------------------------------------------------------------------------EAAAQQQESATTQKAEKEVT----RMVIIMVIA----FLICWL----PYAGVAFYIFTH---------QGS------------DFGPIFMTIPAFF-------AK----TSAVYNPVIYIMM----------------NKQFRNCM--VTTLCCGKNPLGDDEASTTVS
26 HHSearch 68.1312%-142 - C7 -2RH1 ADRB2_HUMAN (first) A:[40-477] -----------------------------------------------------------------------------VVGMGIVMSLIVLAIVFGNVLVITAIAK---F---------ERLQ-TVTN--------------------YF-ITSLACADLVM-GLA-V--VPFGAAHILMKMWTFG----NF-WCEFWTSIDVLCVTA------SIETLCVIAVDRYFAIT-------S--PFKYQ------SLLT------KNKARV---------IILMVWIVSGLTSFLP------------IQMHWY-----RATHQE--A-----INCY------AEETC----------CD-FFT-NQA-----YAIA-----SSI-VSFYVPLVIMV------FVYSRVFQEA-------------------KRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKE--H----------------KAL----KTLGIIMGT----FTLCWL----PFFIVNIVHVIQ---------DNL-------------IRKEVYILLNWI-------GY----VNSGFNPLIYC-R----------------SPDFRIAF--QELLCL---------------
30 HHSearch 67.9313%-154 - C7 -2KS9 NK1R_HUMAN A:[33-325] ------------------------------------------------------------------------------VLWAAAYTVIVVTSVVGNVVVMWIILA---H---------KRMR-TVTN--------------------YF-LVNLAFAEASM-AAF-N--TVVNFTYAVHNEWYYG----LF-YCKFHNFFPIAAVFA------SIYSMTAVAFDRYMAII-------H--PLQPR------L--S------ATATKV---------VICVIWVLALLLAFPQ------------GYYSTT-----ETMPS---R-----VVCM------IEWPE----------HPNKIY-EKV-----YHIC-----VTV-LIYFLPLLVIG------YAYTVVGITLWASEIPGDSSDRYHEQVSAK---------------------------------------------------------------------------------------------------------------------------------------------------------------------------R----------------KVV----KMMIVVVCT----FAICWL----PFHIFFLLPYIN---------PDLY---------LKKFIQQVYLAIMWL-------AM----SSTMYNPIIYCCL----------------NDRFRLGF--KHAFRCCPFISAGDYEGLEMK
13 PsiBlast_PDB 60.4126%-113 - C7 -3MKU ? A:[210-410] ---------------------------------------------------------------------------------LLFYIVTS--KRLAHVKVFETFHK---PQPKELIRLFRL-----GF--------------------PV-AAALFFEVTLF-A-V-V--ALLVAP-L---GSTVV----AAHQVALNFS---SLVFM------FPMSIGAAV-------S-------IRVGHKLG------EQDT------KGAAIA---------ANVG---------LMT------------GLATAC-----I-------T-----ALLT------VLFRE----------QI-ALLYTEN-----QVVV-----ALA-MQLLLFAAIYQ