@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu01460: (2016-06-03 )
MKTPFERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLKKLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVKKEDAEQKAREMLQLVGLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFLKGEEMAGWGLDLPETIKFQRHLEAALGVRFNEPMLTIEDAAAEIRALFQGEKTL

Atome Classification :

(48 SA) .........10........20........30........40........50.......----------.60.-----.......70-..---....--..----80....---------...-.90......-------..100----.----.-------------.......--110.---......120-..-.....130.......140.......150.......160.......170-.......180.......190.......200.-....--..210.......220.....-----..230.......240.......250.......260.......270....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKTPFERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVI----------QAGK-----KNKDLKKLR-KK---VGIV--FQ----FPEHQL---------FEE-TVLKDISFG-------PMN------F----G-------------VKKEDAE--QKAR---EMLQLVGLS-EE-LLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIM-DMFYELHQRGNLTTILVTHSMEDAAAYADEM-IVMH--KGTIQASGSPRDLFLKGEEM-----AGWGLDLPETIKFQRHLEAALGVRFNEPMLTIEDAAAEIRALFQGEKTL
1 PsiBlast_PDB 93.3151% -98 - C1 -4MKI ECFA2_CALS4 B:[20-287] --TPYATVALKDINFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKGKIYING--I----------DITD-----KKVSLKDIR-KQ---VGLV--FQ----YPEYQL---------FEE-TVFKDIAFG-------PSN------L----G-------------LSEEEVK--ERVY---EAMEIVGIS-KE-LADKSPFELSGGQKRRVAIAGILAMRPKILILDEPTAGLDPKGKQEIL-NKIKEIHDKYKMITILVSHNMEDIARIADKI-IVMN--RGKIELIGTPREVFREAERL-----EKIGLSVPQITSLARELRKR-GVPIPPDVLTIEEAKEHILRYLRGT---
21 PsiBlast_CBE 92.9251%-101 - C1 -4MKI ECFA2_CALS4 A:[20-287] --TPYATVALKDINFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKGKIYING--I----------DITD-----KKVSLKDIR-KQ---VGLV--FQ----YPEYQL---------FEE-TVFKDIAFG-------PSN------L----G-------------LSEEEVK--ERVY---EAMEIVGIS-KE-LADKSPFELSGGQKRRVAIAGILAMRPKILILDEPTAGLDPKGKQEIL-NKIKEIHDKYKMITILVSHNMEDIARIADKI-IVMN--RGKIELIGTPREVFREAERL-----EKIGLSVPQITSLARELRKR-GVPIPPDVLTIEEAKEHILRYLRGT---
104 HHSearch 92.7953%-100 - C1 -4HUQ - ECFA2_LACBA A:[20-283] ------HTALTDVSLTVPDRGYLAIIGHTGSGKSTLIQQLNALLKPTSGTIKIDEFTI----------TPET-----TNAALKPLR-QH---VGMV--FQ----FPENQL---------FEE-TVRQDIAFG-------PKN------F----G-------------MADADAL--ALAD---EMLTTVGLD-QS-YAERSPFELSGGQMRRVAIAGVLAMQPKVLVLDEPTAGLDPQGRQEMM-RLFARLHQEQGLTIVLVTHQMEDVAQYAEQV-AVMH--EGRLMKFGTPADVFSNREWL-----QDHQLDVPQAAQFARRLRDR-GLTFPKQPLTADQLADYLAQQWA-----
105 HHSearch 92.7552% -96 - C1 -4MKI ECFA2_CALS4 B:[24-287] ------TVALKDINFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKGKIYINGIDI----------TDK-------KVSLKDIR-KQ---VGLV--FQ----YPEYQL---------FEE-TVFKDIAFG-------PSN------L----G-------------LSEEEVK--ERVY---EAMEIVGIS-KE-LADKSPFELSGGQKRRVAIAGILAMRPKILILDEPTAGLDPKGKQEIL-NKIKEIHDKYKMITILVSHNMEDIARIADKI-IVMN--RGKIELIGTPREVFREAERL-----EKIGLSVPQITSLARELRKR-GVPIPPDVLTIEEAKEHILRYLRGT---
2 PsiBlast_PDB 91.6554% -99 - C1 -4HUQ - ECFA2_LACBA A:[16-275] --TPMAHTALTDVSLTVPDRGYLAIIGHTGSGKSTLIQQLNALLKPTSGTIKIDEFTI----------TPET-----TNAALKPLR-QH---VGMV--FQ----FPENQL---------FEE-TVRQDIAFG-------PKN------F----G-------------MADADAL--ALAD---EMLTTVGLD-QS-YAERSPFELSGGQMRRVAIAGVLAMQPKVLVLDEPTAGLDPQGRQEMM-RLFARLHQEQGLTIVLVTHQMEDVAQYAEQV-AVMH--EGRLMKFGTPADVFSNREWL-----QDHQLDVPQAAQFARRLRDR-GLTFPKQPLTADQLA-------------
3 PsiBlast_PDB 87.9554% -92 - C1 -4HZU - ECFA2_LACBA B:[16-275] --TPMAHTALTDVSLTVPDRGYLAIIGHTGSGKSTLIQQLNALLKPTSGTIKIDEFTI----------TPET-----TNAALKPLR-QH---VGMV--FQ----FPENQL---------FEE-TVRQDIAFG-------PKN------F----G-------------MADADAL--ALAD---EMLTTVGLD-QS-YAERSPFELSGGQMRRVAIAGVLAMQPKVLVLDEPTAGLDPQGRQEMM-RLFARLHQEQGLTIVLVTHQMEDVAQYAEQV-AVMH--EGRLMKFGTPADVFSNREWL-----QDHQLDVPQAAQFARRLRDR-GLTFPKQPLTADQLA-------------
4 PsiBlast_PDB 87.2947% -93 - C1 -5D3M ? B:[16-282] --SPLEAIGLDQLNFSLEEGKFIALVGHTGSGKSTLMQHFNALLKPTSGKIEIAGYTI----------TPET-----GNKGLKDLR-RK---VSLA--FQ----FSEAQL---------FEN-TVLKDVEYG-------PRN------F----G-------------FSEDEAR--EAAL---KWLKKVGLK-DD-LIEHSPFDLSGGQMRRVALAGVLAYEPEIICLDEPAAGLDPMGRLEMM-QLFKDYQAAGH-TVILVTHNMDDVADYADDV-LALE--HGRLIKHASPKEVFKDSEWL-----QKHHLAEPRSARFAAKLEAA-GLKLPGQPLTMPELADAIKQSLK-----
121 HHSearch 74.1340%-106 - C1 -3GFO ECFA3_CLOP1 A:[21-254] ------THALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPI----------DYS-------RKGIMKLR-ES---IGIV--FQ----DPDNQL---------FSA-SVYQDVSFG-------AVN------M----K-------------LPEDEIR--KRVD---NALKRTGIE--H-LKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIM-KLLVEMQKELGITIIIATHDIDIVPLYCDNV-FVMK--EGRVILQGNPKEVFAEKEVI-----RKVNLRLPRIGHLMEI---------------------------------
5 PsiBlast_PDB 73.8340%-105 - C1 -3GFO ECFA3_CLOP1 A:[23-254] --------ALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPI----------DYSR-----KG--IMKLR-ES---IGIV--FQ----DPDNQL---------FSA-SVYQDVSFG-------AVN------M----K-------------LPEDEIR--KRVD---NALKRTGI--EH-LKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIM-KLLVEMQKELGITIIIATHDIDIVPLYCDNV-FVMK--EGRVILQGNPKEVFAEKEVI-----RKVNLRLPRIGHLMEI---------------------------------
16 PsiBlast_PDB 71.1541%-105 - C1 -2OLJ ? A:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
33 PsiBlast_CBE 70.8041%-105 - C1 -2OLK ? C:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
34 PsiBlast_CBE 69.5241%-105 - C1 -2OLK ? B:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
17 PsiBlast_PDB 69.4741%-102 - C1 -2OLK ? A:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
27 PsiBlast_CBE 69.4641%-106 - C1 -3C4J ? B:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
32 PsiBlast_CBE 69.4541%-105 - C1 -2OLK ? D:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
26 PsiBlast_CBE 69.3941%-103 - C1 -3C41 ? K:[18-226] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
29 PsiBlast_CBE 69.0641%-100 - C1 -2OUK ? D:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
18 PsiBlast_PDB 69.0441%-104 - C1 -2OUK ? A:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
31 PsiBlast_CBE 68.6141%-103 - C1 -2OUK ? B:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
24 PsiBlast_CBE 68.5139% -97 - C1 -4YMU ? A:[16-228] --------VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKI----------NNGK-----VN--INKVR-QK---VGMV--FQHFNLFPHLTA---------IEN-ITLAPVKVK-------KMN---------------------------KKEAE--ELAV---DLLAKVGLL-DK-K-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVL-NVMKQLANEG-MTMVVVTHEMGFAREVGDRV-IFMD--DGVIVEEGTPEEIFYRAK--------------------------------------------------------
20 PsiBlast_PDB 68.5041%-102 - C1 -3C4J ? A:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
15 PsiBlast_PDB 68.3341% -99 - C1 -3C41 ? J:[18-226] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
23 PsiBlast_CBE 67.9939% -98 - C1 -4YMV ? A:[16-228] --------VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKI----------NNGK-----VN--INKVR-QK---VGMV--FQHFNLFPHLTA---------IEN-ITLAPVKVK-------KMN---------------------------KKEAE--ELAV---DLLAKVGLL-DK-K-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVL-NVMKQLANEG-MTMVVVTHEMGFAREVGDRV-IFMD--DGVIVEEGTPEEIFYRAK--------------------------------------------------------
9 PsiBlast_PDB 67.9339% -95 - C1 -4YMU ? J:[16-228] --------VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKI----------NNGK-----VN--INKVR-QK---VGMV--FQHFNLFPHLTA---------IEN-ITLAPVKVK-------KMN---------------------------KKEAE--ELAV---DLLAKVGLL-DK-K-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVL-NVMKQLANEG-MTMVVVTHEMGFAREVGDRV-IFMD--DGVIVEEGTPEEIFYRAK--------------------------------------------------------
19 PsiBlast_PDB 67.8441%-101 - C1 -2Q0H ? A:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
28 PsiBlast_CBE 67.7941%-103 - C1 -2Q0H ? B:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
10 PsiBlast_PDB 66.7639% -94 - C1 -4YMV ? J:[16-228] --------VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKI----------NNGK-----VN--INKVR-QK---VGMV--FQHFNLFPHLTA---------IEN-ITLAPVKVK-------KMN---------------------------KKEAE--ELAV---DLLAKVGLL-DK-K-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVL-NVMKQLANEG-MTMVVVTHEMGFAREVGDRV-IFMD--DGVIVEEGTPEEIFYRAK--------------------------------------------------------
35 PsiBlast_CBE 66.5341% -99 - C1 -2OLJ ? B:[39-247] --------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINL----------KA-------KDTNLNKVR-EE---VGMV--FQ------RFNL---------FPHMTVLNNITLA-------PMK------VR---K-------------WPREKAE--AKAM---ELLDKVGLK-DK-A-HAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-SVMKQLANEG-MTMVVVTHEMGFAREVGDRV-LFMD--GGYIIEEGKPEDLF------------------------------------------------------------
72 PsiBlast_CBE 66.4436% -90 - C1 -3FVQ FBPC_NEIG1 B:[20-260] ---------LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI----------FS-------KNTNLPVRE-RR---LGYL--VQ------EGVL---------FPHLTVYRNIAYG-------LGN------G----K-------------GRTAQER--QRIE---AMLELTGIS-E--LAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGK-SAVFVSHDREEALQYADRI-AVMK--QGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLG---------------------------
73 PsiBlast_CBE 65.7436% -90 - C1 -3FVQ FBPC_NEIG1 A:[20-265] ---------LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI----------FS-------KNTNLPVRE-RR---LGYL--VQ------EGVL---------FPHLTVYRNIAYG-------LGN------G----K-------------GRTAQER--QRIE---AMLELTGIS-E--LAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGK-SAVFVSHDREEALQYADRI-AVMK--QGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLG---------------------------
102 PsiBlast_CBE 65.4034%-115 - C1 -1G6H LIVG_METJA A:[22-235] --------ALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDI----------T---------NKEPAELY-H----YGIVRTFQ----TPQ-PL---------KEM-TVLENLLIGEICPGESPLNSLFYKKW----I-------------PKEEEMV--EKAF---KILEFLKLS-H--LYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIF-NHVLELKAKG-ITFLIIEHRLDIVLNYIDHL-YVMF--NGQIIAEG------------------------------------------------------------------
40 PsiBlast_CBE 64.4636% -93 - C1 -4U00 ? A:[19-231] --------VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLSV-------------K-----DDRALREIR-RE---VGMV--FQ------QFNL---------FPHMTVLENVTLA-------PMR------V----RR------------WPREKAE--KKAL---ELLERVGIL-DQ-A-RKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVL-DVMRDLAQ-GGMTMVVVTHEMGFAREVADRV-VFMD--GGQIVEEGRPEEIFTRPKE-------------------------------------------------------
95 PsiBlast_CBE 64.0434%-113 - C1 -1G9X LIVG_METJA B:[22-235] --------ALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDI----------T---------NKEPAELY-H----YGIVRTFQ----TPQ-PL---------KEM-TVLENLLIG-------EIN------P----GESPLNSLFYKKWIPKEEEMV--EKAF---KILEFLKLS-H--LYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIF-NHVLELKAKG-ITFLIIEHRLDIVLNYIDHL-YVMF--NGQIIAEG------------------------------------------------------------------
77 PsiBlast_CBE 63.8133%-112 - C1 -3TIF Y796_METJA B:[20-224] --------ALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT----------NDLD-----DDELTKIRR-DK---IGFV--FQQ---FNLIPL---------L---TALENVEL--------PLI------FKYRGA-------------MSGEERR--KRAL---ECLKMAELE-ER-FANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIM-QLLKKLNEEDGKTVVVVTHDI-NVARFGERI-IYLK--DGEVE---------------------------------------------------------------------
78 PsiBlast_CBE 63.3933%-106 - C1 -3TIF Y796_METJA A:[20-224] --------ALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT----------NDLD-----DDELTKIRR-DK---IGFV--FQQ---FNLIPL---------L---TALENVEL--------PLI------FKYRGA-------------MSGEERR--KRAL---ECLKMAELE-ER-FANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIM-QLLKKLNEEDGKTVVVVTHDI-NVARFGERI-IYLK--DGEVE---------------------------------------------------------------------
96 PsiBlast_CBE 63.3434%-111 - C1 -1G9X LIVG_METJA A:[22-235] --------ALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDI----------T---------NKEPAELY-H----YGIVRTFQ----TPQ-PL---------KEM-TVLENLLIG-------EIN------P----GESPLNSLFYKKWIPKEEEMV--EKAF---KILEFLKLS-H--LYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIF-NHVLELKAKG-ITFLIIEHRLDIVLNYIDHL-YVMF--NGQIIAEG------------------------------------------------------------------
94 PsiBlast_CBE 63.0234%-110 - C1 -1G9X LIVG_METJA C:[22-235] --------ALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDI----------T---------NKEPAELY-H----YGIVRTFQ----TPQ-PL---------KEM-TVLENLLIG-------EIN------P----GESPLNSLFYKKWIPKEEEMV--EKAF---KILEFLKLS-H--LYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIF-NHVLELKAKG-ITFLIIEHRLDIVLNYIDHL-YVMF--NGQIIAEG------------------------------------------------------------------
75 PsiBlast_CBE 62.5533%-107 - C1 -1L2T Y796_METJA A:[20-224] --------ALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT----------NDLD-----DDELTKIRR-DK---IGFV--FQQ---FNLIPL---------L---TALENVEL--------PLI------FKYRGA-------------MSGEERR--KRAL---ECLKMAELE-ER-FANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIM-QLLKKLNEEDGKTVVVVTHDI-NVARFGERI-IYLK--DGEVE---------------------------------------------------------------------
74 PsiBlast_CBE 62.5333%-108 - C1 -1L2T Y796_METJA B:[20-224] --------ALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT----------NDLD-----DDELTKIRR-DK---IGFV--FQQ---FNLIPL---------L---TALENVEL--------PLI------FKYRGA-------------MSGEERR--KRAL---ECLKMAELE-ER-FANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIM-QLLKKLNEEDGKTVVVVTHDI-NVARFGERI-IYLK--DGEVE---------------------------------------------------------------------
110 HHSearch 61.4435% -91 - C1 -3FVQ FBPC_NEIG1 A:[16-235] -----NTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI----------FSK-------NTNLPVRE-RR---LGYL--VQ----EGV-LF---------PHL-TVYRNIAYG-------LGN------G----K-------------GRTAQER--QRIE---AMLELTGIS--E-LAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIR-EDMIAALRANGKSAVFVSHDREEALQYADRI-AVMK--QGRILQTASPHELYRQP---------------------------------------------------------
14 PsiBlast_PDB 60.8338% -93 - C1 -4HLU ECFA2_THEMA A:[18-223] --TPLEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGD------VL----------YDGE-----RKKGYE-IR-RN---IGIA--FQ----YPEDQF---------FAE-RVFDEVAFA-------VKN------F------------------YPDRDPV--PLVK---KAMEFVGLDFDS-FKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLL-RIVEKWKTLGK-TVILISHDIETVINHVDRV-VVLE--KGKKVFDGT-----------------------------------------------------------------
25 PsiBlast_CBE 60.6138% -93 - C1 -4HLU ECFA2_THEMA B:[18-223] --TPLEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGD------VL----------YDGE-----RKKGYE-IR-RN---IGIA--FQ----YPEDQF---------FAE-RVFDEVAFA-------VKN------F------------------YPDRDPV--PLVK---KAMEFVGLDFDS-FKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLL-RIVEKWKTLGK-TVILISHDIETVINHVDRV-VVLE--KGKKVFDGT-----------------------------------------------------------------
13 PsiBlast_PDB 60.5238% -97