@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3307: (2016-05-18 )
MADPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF

Atome Classification :

(73 SA) .........10........20........30........40........50....------....60........70........80........90........100.......110.......120.......130.......140---.-..---...-------.-------150-----..-------.......160...----..----..170------.--.------..--...180.......190.......200.......210.......220.......230-.......--.--240..---.....250.......260......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MADPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
2 PsiBlast_PDB 98.70100%-120 - C5 -1I80 PUNA_MYCTU A:[3-268] --DPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
22 PsiBlast_CBE 98.64100%-122 - C5 -3IOM PUNA_MYCTU B:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
5 PsiBlast_PDB 98.47100%-120 - C5 -3SCZ PUNA_MYCTU A:[6-268] -----PDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
26 PsiBlast_CBE 98.29100%-122 - C5 -1I80 PUNA_MYCTU B:[6-268] -----PDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
21 PsiBlast_CBE 98.22100%-120 - C5 -3SCZ PUNA_MYCTU B:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
4 PsiBlast_PDB 98.14100%-121 - C5 -3IOM PUNA_MYCTU A:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
25 PsiBlast_CBE 97.69100%-122 - C5 -1I80 PUNA_MYCTU C:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
23 PsiBlast_CBE 97.59100%-120 - C5 -1N3I PUNA_MYCTU C:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
27 PsiBlast_CBE 97.52100%-119 - C5 -1G2O PUNA_MYCTU C:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
28 PsiBlast_CBE 97.44100%-116 - C5 -1G2O PUNA_MYCTU B:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
24 PsiBlast_CBE 97.24100%-117 - C5 -1N3I PUNA_MYCTU B:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
3 PsiBlast_PDB 97.10100%-116 - C5 -1N3I PUNA_MYCTU A:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
112 HHSearch 96.68100%-118 - C5 -1G2O PUNA_MYCTU A:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
1 PsiBlast_PDB 96.68100%-118 - C5 -1G2O PUNA_MYCTU A:[7-268] ------DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQA------ELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---T-AR---SPL-------V-------G-------GE-------FVDLTDAYSPRLR----EL----ARQSD------P--Q------LA--EGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTN--LAAGITG--E--PLSHA---EVLAAGAASATRMGALLADVIARF
32 PsiBlast_CBE 81.5056%-104 - C5 -1C3X PUNA_CELSP B:[3-266] LDDPATDPFLVARAAADHIAQATGVEGHDMALVLGSGWGGAAELLGEVVAEVPTH------EIPGF---SSVTRSIRVERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINL---T-AR---SPL-------E-------G-------PT-------FVDLTDVYSPRLR----EL----AHRVD------P--T------LP--EGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTN--LAAGISP--T--PLSHA---EVIEAGQAAGPRISALLADIAKR-
30 PsiBlast_CBE 81.3056%-102 - C5 -1QE5 PUNA_CELSP B:[3-266] LDDPATDPFLVARAAADHIAQATGVEGHDMALVLGSGWGGAAELLGEVVAEVPTH------EIPGF---SSVTRSIRVERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINL---T-AR---SPL-------E-------G-------PT-------FVDLTDVYSPRLR----EL----AHRVD------P--T------LP--EGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTN--LAAGISP--T--PLSHA---EVIEAGQAAGPRISALLADIAKR-
31 PsiBlast_CBE 81.0856%-103 - C5 -1C3X PUNA_CELSP C:[3-266] LDDPATDPFLVARAAADHIAQATGVEGHDMALVLGSGWGGAAELLGEVVAEVPTH------EIPGF---SSVTRSIRVERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINL---T-AR---SPL-------E-------G-------PT-------FVDLTDVYSPRLR----EL----AHRVD------P--T------LP--EGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTN--LAAGISP--T--PLSHA---EVIEAGQAAGPRISALLADIAKR-
7 PsiBlast_PDB 80.4456%-101 - C5 -1QE5 PUNA_CELSP A:[3-266] LDDPATDPFLVARAAADHIAQATGVEGHDMALVLGSGWGGAAELLGEVVAEVPTH------EIPGF---SSVTRSIRVERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINL---T-AR---SPL-------E-------G-------PT-------FVDLTDVYSPRLR----EL----AHRVD------P--T------LP--EGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTN--LAAGISP--T--PLSHA---EVIEAGQAAGPRISALLADIAKR-
6 PsiBlast_PDB 80.1156%-101 - C5 -1C3X PUNA_CELSP A:[3-266] LDDPATDPFLVARAAADHIAQATGVEGHDMALVLGSGWGGAAELLGEVVAEVPTH------EIPGF---SSVTRSIRVERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINL---T-AR---SPL-------E-------G-------PT-------FVDLTDVYSPRLR----EL----AHRVD------P--T------LP--EGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTN--LAAGISP--T--PLSHA---EVIEAGQAAGPRISALLADIAKR-
29 PsiBlast_CBE 79.6456%-102 - C5 -1QE5 PUNA_CELSP C:[3-266] LDDPATDPFLVARAAADHIAQATGVEGHDMALVLGSGWGGAAELLGEVVAEVPTH------EIPGF---SSVTRSIRVERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINL---T-AR---SPL-------E-------G-------PT-------FVDLTDVYSPRLR----EL----AHRVD------P--T------LP--EGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTN--LAAGISP--T--PLSHA---EVIEAGQAAGPRISALLADIAKR-
121 HHSearch 76.7035%-110 - C5 -3ODG ? A:[16-284] ---------ELPFQAVKYIQKIKPGFKPQIAFILGSGLGDLVDQITND-TTISYA------DIPGFPVSSVHGHAGELVLGDLCGVPVMCMKGRGHFYEGKGMSIMTNPVRTFKLMGCEFLFCTNAAGSLRPEVLPGSVVMLKDHINT---M-PG---TPL-------VGPNDDRFG-------PR-------FFSLANAYDKDLR----AD----MAKIAQQLD--I--P------LT--EGVFVSYPGPCFETPAEIRMMQIIGGDVVGMSVVPEVLSAAHCGLKVIALTAITN--LAEGLSD--V--VLSHE---QTLKFAKVASVNFTKLIEAFLKSK
122 HHSearch 76.1535%-105 - C5 -4LNA ? A:[23-293] -------MFEQIQETTQFIQSKIT-LRPAIGIILGTGLGALTNELDID-TTIPYE------TIPHFPLSTV---SGKLLIGTLGGKSVVVMQGRFHYYEGYTMQQVTYPVRVMHALGIQTLLVSNAAGGMNPTFQTSDLMVIDDHISL---LLPQ---NPL-------ICPNPPIFG-------DR-------FPDMSEPYRKSLI----DL----AFSVAAELD--I--P------LK--RGVYVSVTGPQLETRAEYRMLRQWGADAVGMSTVPEVIVANQLGMDVFGISVITD--LCFPDTL--E--KAELV---KILATAAQAEPKLTMLIREMIGRL
114 HHSearch 75.0638%-103 - C5 -3FUC PNPH_BOVIN A:[3-282] ----NGYTYEDYQDTAKWLLSHTE-QRPQVAVICGSGLGGLVNKLTQA-QTFDYS------EIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINL---P-GFSGENPL-------R-------GPNEERFGVR-------FPAMSDAYDRDMR----QK----AHSTWKQMGEQR--E------LQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITN--KVIMDYESQG--KANHE---EVLEAGKQAAQKLEQFVSLLMASI
120 HHSearch 75.0433%-100 - C5 -2P4S ? A:[90-367] ------YTYDTLQEIATYLLERTE-LRPKVGIICGSGLGTLAEQLTDV-DSFDYE------TIPHFPVSTVAGHVGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPKYRVGDIMLIKDHINL---M-GFAGNNPL-------Q-------GPNDERFGPR-------FFGMANTYDPKLN----QQ----AKVIARQIG--IENE------LR--EGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITN--MCTMSYEEEE--EHCHD---SIVGVGKNREKTLGEFVSRIVKHI
8 PsiBlast_PDB 75.0136%-105 - C5 -3ODG ? A:[13-277] ------DFNELPFQAVKYIQKIKPGFKPQIAFILGSGLGDLVDQITNDTTI-SYA------DIPGFPVSSVHGHAGELVLGDLCGVPVMCMKGRGHFYEGKGMSIMTNPVRTFKLMGCEFLFCTNAAGSLRPEVLPGSVVMLKDHINT---M-PG---TPL-------V-------G-------PNDDRFGPRFFSLANAYDKDLRADMAKI----AQQLD------I--P------LT--EGVFVSYPGPCFETPAEIRMMQIIGGDVVGMSVVPEVLSAAHCGLKVIALTAITN--LAEGLSD--V--VLSHE---QTLKFAKVASVNFTKLI-------
111 HHSearch 74.5535%-105 - C5 -4NSN ? A:[26-295] -------QEQHYHEAASFLSSRLP-GDAKTAIILGSGLGELAEKIENK-TVIPYN------EIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHINN---L-PN---PLIGPNMDM-F-------G-------VR-------FPDMTRAYDREFI----AK----AKGIAQELN--I--P------VK--EGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITN--EGYHFADD-F--VNDEQ---DVIRAANAASEKMGAIFARLIAAV
15 PsiBlast_PDB 73.8538%-104 - C5 -1A9S PNPH_BOVIN A:[26-280] ----------------------------QVAVICGSGLGGLVNKLTQAQT-FDYS------EIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-GE---NPLRGPNEERF-------G-------VR-------FPAMSDAYDRDMR----QK----AHSTW------K--QMGEQRELQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITN--KVIMDTE--SQGKANHE---EVLEAGKQAAQKLEQFVSLLMA--
10 PsiBlast_PDB 73.6138%-104 - C5 -1A9Q PNPH_BOVIN A:[26-280] ----------------------------QVAVICGSGLGGLVNKLTQAQT-FDYS------EIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-GE---NPLRGPNEERF-------G-------VR-------FPAMSDAYDRDMR----QK----AHSTW------K--QMGEQRELQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITN--KVIMDTE--SQGKANHE---EVLEAGKQAAQKLEQFVSLLMA--
124 HHSearch 73.5835%-105 - C5 -1TCV ? A:[3-284] --ESVTANIENVKKVAHHIQKLTS-IVPEIGIICGSGLGKLADGVKDK-ITIPYT------KIPNFPQTS---HSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYL---P-GLGLNNIL-------V-------GPNQEAFGTR-------FPALSNAYDRDLR----KL----AVQVAEENG--FGNL------VH--QGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTN--ISVLDVESD----------------GAQRAELMQSWFEKIIEKL
11 PsiBlast_PDB 73.5038%-105 - C5 -1A9R PNPH_BOVIN A:[26-280] ----------------------------QVAVICGSGLGGLVNKLTQAQT-FDYS------EIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-GE---NPLRGPNEERF-------G-------VR-------FPAMSDAYDRDMR----QK----AHSTW------K--QMGEQRELQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITN--KVIMDTE--SQGKANHE---EVLEAGKQAAQKLEQFVSLLMA--
12 PsiBlast_PDB 73.3438%-104 - C5 -1A9T PNPH_BOVIN A:[26-280] ----------------------------QVAVICGSGLGGLVNKLTQAQT-FDYS------EIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-GE---NPLRGPNEERF-------G-------VR-------FPAMSDAYDRDMR----QK----AHSTW------K--QMGEQRELQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITN--KVIMDTE--SQGKANHE---EVLEAGKQAAQKLEQFVSLLMA--
47 PsiBlast_CBE 73.3338%-105 - C5 -1B8O PNPH_BOVIN A:[26-280] ----------------------------QVAVICGSGLGGLVNKLTQAQT-FDYS------EIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-GE---NPLRGPNEERF-------G-------VR-------FPAMSDAYDRDMR----QK----AHSTW------K--QMGEQRELQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQ--G--KANHE---EVLEAGKQAAQKLEQFVSLLMA--
48 PsiBlast_CBE 73.2738%-108 - C5 -1B8N PNPH_BOVIN A:[26-279] ----------------------------QVAVICGSGLGGLVNKLTQAQT-FDYS------EIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-GE---NPLRGPNEERF-------G-------VR-------FPAMSDAYDRDMR----QK----AHSTW------K--QMGEQRELQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQ--G--KANHE---EVLEAGKQAAQKLEQFVSLLM---
14 PsiBlast_PDB 72.5438%-102 - C5 -1A9P PNPH_BOVIN A:[26-280] ----------------------------QVAVICGSGLGGLVNKLTQAQT-FDYS------EIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-GE---NPLRGPNEERF-------G-------VR-------FPAMSDAYDRDMR----QK----AHSTW------K--QMGEQRELQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITN--KVIMDTE--SQGKANHE---EVLEAGKQAAQKLEQFVSLLMA--
9 PsiBlast_PDB 72.5138%-106 - C5 -1FXU PNPH_BOVIN A:[26-280] ----------------------------QVAVICGSGLGGLVNKLTQAQT-FDYS------EIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-GQ---NPLRGPNEERF-------G-------VR-------FPAMSDAYDRDMR----QK----AHSTW------K--QMGEQRELQ--EGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITN--KVIMDT----G-KANHE---EVLEAGKQAAQKLEQFVSLLMA--
91 PsiBlast_CBE 72.1038%-107 - C5 -1YQQ XAPA_ECOLI A:[28-275] -----------------------------VAFILGSG-LGALADQIENAVAISYE------KLPGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTFKLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINT---M-PG---TPM-------V-------GLNDDRF-GER------FFSLANAYDAEYR----ALLQKVAKEEG------F--P------LT--EGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITN--MAEGLSD--V--KLSHA---QTLAAAELSKQNFINLICGFLRK-
75 PsiBlast_CBE 71.9339%-111 - C5 -1V2H PNPH_HUMAN E:[26-279] -----------------------------VAIICGSG-------LGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-GQ---NPLRGPNDERF-------G-------DR-------FPAMSDAYDRTMR----QR----ALSTW------K--QMGEQRELQ--EGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL--E--KANHE---EVLAAGKQAAQKLEQFVSILMA--
71 PsiBlast_CBE 71.8139%-108 - C5 -1PF7 PNPH_HUMAN E:[27-280] -----------------------------VAIICGSG-------LGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-GQ---NPLRGPNDERF-------G-------DR-------FPAMSDAYDRTMR----QR----ALSTW------K--QMGEQRELQ--EGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL--E--KANHE---EVLAAGKQAAQKLEQFVSILMA--