@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00089_TRY1_H: (2014-08-23 )
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0IV_A_2(1ZZZ)
TRY1_BOVIN
[Raw transfer]




PR1_A_5(1F0T)
TRY1_BOVIN
[Raw transfer]




RPR_A_4(1F0U)
TRY1_BOVIN
[Raw transfer]




BEN_A_2(1H4W)
TRY3_HUMAN
[Raw transfer]




BEN_A_4(1J14)
TRY2_RAT
[Raw transfer]




BEN_A_3(1ANC)
TRY2_RAT
[Raw transfer]




BAM_X_2(2BY8)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BYA)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(1AND)
TRY2_RAT
[Raw transfer]




BEN_C_3(1ANE)
TRY2_RAT
[Raw transfer]




BEN_A_3(4I8H)
TRY1_BOVIN
[Raw transfer]




BEN_A_5(1DPO)
TRY2_RAT
[Raw transfer]




BAM_X_2(2BY6)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(1ANB)
TRY2_RAT
[Raw transfer]




BAM_X_2(2BY7)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY5)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY9)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(1BRA)
TRY2_RAT
[Raw transfer]




BEN_B_6(1TRM)
TRY2_RAT
[Raw transfer]




BEN_A_3(2TRM)
TRY2_RAT
[Raw transfer]




BEN_A_5(1TRM)
TRY2_RAT
[Raw transfer]




IMA_A_4(1LQE)
TRY1_BOVIN
[Raw transfer]




BEN_A_8(2AIQ)
VSPCA_AGKCO
[Raw transfer]




BEN_A_3(1LO6)
KLK6_HUMAN
[Raw transfer]




PBZ_A_11(2BDG)
KLK4_HUMAN
[Raw transfer]




ZEN_A_4(1QL9)
TRY2_RAT
[Raw transfer]




CHAIN_B_2(1YF4)
TRYP_PIG
[Raw transfer]

-

K7J_A_2(2QXI)
KLK7_HUMAN
[Raw transfer]




CHAIN_B_2(3S9C)
VSPG_DABSI
[Raw transfer]

-

EDO_E_6(3FP7)
TRY2_RAT
[Raw transfer]




EDO_E_8(3FP6)
TRY2_RAT
[Raw transfer]




EDO_E_7(3FP8)
TRY2_RAT
[Raw transfer]




CHAIN_I_3(1FXY)
TRY1_HUMAN
[Raw transfer]

-

CHAIN_I_2(3FP7)
TRY2_RAT
[Raw transfer]

-

DFP_A_3(2TGD)
TRY1_BOVIN
[Raw transfer]




CHAIN_B_2(2PSX)
KLK5_HUMAN
[Raw transfer]

-

ACE_B_4(2PSX)
KLK5_HUMAN
[Raw transfer]




CH2_I_5(1FXY)
TRY1_HUMAN
[Raw transfer]




6 PsiBlast_PDB 96.1087%-105 - C1 -1H4W 3.2 TRY3_HUMAN
87 PsiBlast_CBE 91.7778%-103 - C1 -1YF4 7.8 TRYP_PIG
66 PsiBlast_CBE 91.0779%-105 - C1 -1J14 3.0 TRY2_RAT
47 PsiBlast_CBE 90.6979%-105 - C1 -3FP8 2.1 TRY2_RAT
54 PsiBlast_CBE 90.5979%-104 - C1 -1DPO 3.3 TRY2_RAT
67 PsiBlast_CBE 90.5579%-103 - C1 -1BRA 2.6 TRY2_RAT
48 PsiBlast_CBE 90.5379%-104 - C1 -3FP7 3.5 TRY2_RAT
41 PsiBlast_CBE 90.4680%-105 - C1 -3FP6 3.1 TRY2_RAT
56 PsiBlast_CBE 90.4579%-106 - C1 -1TRM 3.2 TRY2_RAT
35 PsiBlast_CBE 90.2373%-107 - C1 -1F0U 8.0 TRY1_BOVIN
60 PsiBlast_CBE 90.2179%-102 - C1 -1AND 3.2 TRY2_RAT
65 PsiBlast_CBE 90.1579%-104 - C1 -1QL9 6.6 TRY2_RAT
42 PsiBlast_CBE 90.1180%-104 - C1 -1ANE 3.2 TRY2_RAT
52 PsiBlast_CBE 89.9579%-103 - C1 -1ANB 3.6 TRY2_RAT
57 PsiBlast_CBE 89.7879%-103 - C1 -1TRM 3.1 TRY2_RAT
55 PsiBlast_CBE 89.7579%-105 - C1 -2TRM 3.1 TRY2_RAT
39 PsiBlast_CBE 89.0674%-103 - C1 -1ZZZ 4.0 TRY1_BOVIN
114 HHSearch 89.0075%-104 - C1 -4I8H 3.3 TRY1_BOVIN
34 PsiBlast_CBE 88.9373%-106 - C1 -1LQE 7.1 TRY1_BOVIN
36 PsiBlast_CBE 88.7873%-104 - C1 -1F0T 5.5 TRY1_BOVIN
30 PsiBlast_CBE 88.7773%-106 - C1 -2BY8 3.5 TRY1_BOVIN
28 PsiBlast_CBE 88.5973%-105 - C1 -2BYA 3.5 TRY1_BOVIN
53 PsiBlast_CBE 88.5179%-102 - C1 -1ANC 3.5 TRY2_RAT
32 PsiBlast_CBE 88.3173%-105 - C1 -2BY6 3.4 TRY1_BOVIN
29 PsiBlast_CBE 88.2373%-105 - C1 -2BY9 3.4 TRY1_BOVIN
31 PsiBlast_CBE 88.2173%-105 - C1 -2BY7 3.4 TRY1_BOVIN
33 PsiBlast_CBE 88.0773%-104 - C1 -2BY5 3.5 TRY1_BOVIN
116 HHSearch 86.6870% -99 - C1 -1FXY 4.0 TRY1_HUMAN
77 PsiBlast_CBE 84.0275%-100 - C1 -2TGD 2.6 TRY1_BOVIN
129 HHSearch 77.4242% -96 - C1 -2QXI 4.0 KLK7_HUMAN
118 HHSearch 76.5347% -88 - C1 -2PSX 3.4 KLK5_HUMAN
117 HHSearch 75.7045%-101 - C1 -1LO6 2.8 KLK6_HUMAN
126 HHSearch 75.6041% -93 - C1 -2BDG 3.0 KLK4_HUMAN
136 HHSearch 70.2139% -87 - C1 -2AIQ 3.0 VSPCA_AGKCO
130 HHSearch 68.2838% -88 - C1 -3S9C 0.7 VSPG_DABSI