@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0177: (2015-11-29 )
MKIKVGVIGCSGRMGKRILNELITNTQVEIAGAVARLGSKYIGSDIGSAVYHSSNLGIKVTSSISDVFESSDVVIDFTTKECMLACLKAAMKFKTPLVSGTTGIESINLKKYAAKIPILWSANMSVGVNVLLKLVKKAAEFLDNEYDVEIWEMHHNLKKDSPSGTAMEFGKAIANALKVDFQPYQHSHNSSNIREKGKIGFAVSRGGGVVGDHSVMFINSDERIELNHKAIDRTTFARGAVRAAIWLYENKRETPGLYSMQDVI

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_B_18(1VM6)
DAPB_THEMA
[Raw transfer]




NDP_E_5(1DIH)
DAPB_ECOLI
[Raw transfer]




NAD_A_17(1VM6)
DAPB_THEMA
[Raw transfer]




NAP_A_5(3IJP)
DAPB_BARHE
[Raw transfer]




NDP_E_5(1DIH)
DAPB_ECOLI
[Raw transfer]




NAD_A_17(1VM6)
DAPB_THEMA
[Raw transfer]




NAD_D_20(1VM6)
DAPB_THEMA
[Raw transfer]




NHD_E_5(1DRW)
DAPB_ECOLI
[Raw transfer]




NAD_A_3(4YWJ)
DAPB_PSEAE
[Raw transfer]




NAD_B_7(4YWJ)
DAPB_PSEAE
[Raw transfer]




NAD_E_5(1DRU)
DAPB_ECOLI
[Raw transfer]




NAD_D_12(1ARZ)
DAPB_ECOLI
[Raw transfer]




NAD_C_10(1ARZ)
DAPB_ECOLI
[Raw transfer]




A3D_E_5(1DRV)
DAPB_ECOLI
[Raw transfer]




NAD_B_8(1ARZ)
DAPB_ECOLI
[Raw transfer]




GOL_B_18(3QY9)
DAPB_STAAC
[Raw transfer]




PDC_G_7(1P9L)
DAPB_MYCTU
[Raw transfer]




PDC_I_9(1C3V)
DAPB_MYCTU
[Raw transfer]




PG4_C_22(1VM6)
DAPB_THEMA
[Raw transfer]




1 PsiBlast_PDB 94.1741%-130 - C6 -4YWJ 10.6 DAPB_PSEAE
21 PsiBlast_CBE 91.3541%-126 - C6 -4YWJ 10.0 DAPB_PSEAE
23 PsiBlast_CBE 89.8838%-116 - C6 -3IJP - DAPB_BARHE -
34 HHSearch 89.0442%-127 * C6 *1DIH 8.7 DAPB_ECOLI
3 PsiBlast_PDB 88.2038%-114 - C6 -3IJP 11.7 DAPB_BARHE
2 PsiBlast_PDB 88.0738%-119 - C6 -4F3Y - DAPB_BURTA -
22 PsiBlast_CBE 87.1638%-117 - C6 -4F3Y - DAPB_BURTA -
5 PsiBlast_PDB 84.4139%-120 - C6 -1DIH 8.7 DAPB_ECOLI
6 PsiBlast_PDB 83.6539%-112 - C6 -1DRU 7.4 DAPB_ECOLI
8 PsiBlast_PDB 83.2439%-111 - C6 -1DRW 8.6 DAPB_ECOLI
7 PsiBlast_PDB 83.1339%-120 - C6 -1DRV 7.3 DAPB_ECOLI
4 PsiBlast_PDB 82.5239%-114 - C6 -1ARZ - DAPB_ECOLI -
26 PsiBlast_CBE 82.1739%-116 - C6 -1ARZ 7.3 DAPB_ECOLI
25 PsiBlast_CBE 80.2839%-110 - C6 -1ARZ 6.3 DAPB_ECOLI
24 PsiBlast_CBE 79.1539%-111 - C6 -1ARZ 6.4 DAPB_ECOLI
36 HHSearch 75.1633%-115 - C6 -3QY9 - DAPB_STAAC -
53 Fugue 74.6833%-102 - C6 -3QY9 - DAPB_STAAC -
33 HHSearch 71.4939%-114 - C6 -1VM6 9.9 DAPB_THEMA
28 PsiBlast_CBE 69.9632%-117 - C6 -1VM6 2.0 DAPB_THEMA
29 PsiBlast_CBE 68.4232%-109 - C6 -1VM6 9.2 DAPB_THEMA
27 PsiBlast_CBE 67.2832%-106 - C6 -1VM6 9.0 DAPB_THEMA
9 PsiBlast_PDB 67.1932%-105 - C6 -1VM6 9.2 DAPB_THEMA
32 PsiBlast_CBE 60.0437% -85 - C6 -3QY9 2.9 DAPB_STAAC