@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0238: (2015-11-29 )
MFEWNTNNIIDATGGRGKSGCHNLNISTDTRNIKKGDLFIALKGKNFDGHDFLHEAFLKGAAAAVVSEDKYRNLPVIVVQDTLKALHDMASYYIRNVLVNAEVIAITGSVGKTTTKDMLHTVLSQYGVSHVNDGNLNNNIGLPLTILKAPENCRYLILEMGMNKAGEIKELSKISNPNIAVITNIEPVHVENFSSLFDIAQAKLEILYGVKNNGTLILNKDNKYYDYLLSHVDRDVVSFGRSESATVCLLNVIKNDKGLNLKIRLNNNQIMNCNLCVQGKHFVYSVLAVVAVIQNLGLNLSKLPLALENFNITKGRGSVHKAKYNGKCIHLIDDSYNASPASMKAAIRTLGIYSNRRKVALLGDMLELGNKSITFHMKLLDSIVKYDVDKVYTVGKFMLKLHRLLPGNIKGTHFNDSNQLKSNLANIVQNNDVVLVKGSRGVKMDFIVQGFIIEY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2GN_A_2(3ZM6)
?
[Raw transfer]




ANP_A_6(4CVM)
?
[Raw transfer]




API_A_6(4CVK)
?
[Raw transfer]




ALA_A_2(4CVM)
?
[Raw transfer]




ATP_A_2(4QDI)
?
[Raw transfer]




ANP_A_2(4ZIY)
?
[Raw transfer]




IGM_A_2(3ZM5)
?
[Raw transfer]




1LG_A_2(2AM1)
?
[Raw transfer]




ALA_A_2(4CVK)
?
[Raw transfer]




2LG_A_2(2AM2)
?
[Raw transfer]




UDP_A_3(4CVK)
?
[Raw transfer]




MUB_A_4(4CVK)
?
[Raw transfer]




4 PsiBlast_PDB 95.8033%-108 - C1 -3ZM6 9.2 ?
1 PsiBlast_PDB 95.6335%-106 - C1 -4CVK 6.3 ?
9 PsiBlast_PDB 95.5631%-100 - C1 -4ZIY 7.9 ?
3 PsiBlast_PDB 95.5533%-111 - C1 -3ZM5 7.6 ?
2 PsiBlast_PDB 94.8735%-102 - C1 -4CVM 6.5 ?
8 PsiBlast_PDB 94.6931% -99 - C1 -4QDI 7.6 ?
6 PsiBlast_PDB 94.2332%-108 - C1 -2AM1 5.5 ?
7 PsiBlast_PDB 94.0932%-114 - C1 -2AM2 5.6 ?
10 PsiBlast_PDB 88.6128%-101 - C1 -3ZL8 - ? -
12 PsiBlast_PDB 77.6824% -89 - C1 -1GQY - MURC_HAEIN -
29 HHSearch 76.9722% -89 * C1 *1P3D - MURC_HAEIN -
13 PsiBlast_PDB 74.8824% -99 - C1 -4HV4 - MURC_YERPE -
14 PsiBlast_PDB 73.1424% -93 - C1 -2F00 - MURC_ECOLI -
24 HHSearch 72.2524% -75 - C1 -3LK7 - MURD_STRA5 -
5 PsiBlast_PDB 71.8432% -15 - C1 -1GG4 - MURF_ECOLI -
15 PsiBlast_PDB 70.8224%-106 - C1 -4BUB - MURE_THEMA -
17 PsiBlast_PDB 69.6624% -90 - C1 -1P3D - MURC_HAEIN -
16 PsiBlast_PDB 69.2624% -91 - C1 -1P31 - MURC_HAEIN -
21 HHSearch 67.8432% 1 - C1 -1GG4 - MURF_ECOLI -
31 HHSearch 64.5619% -73 - C1 -3NRS - ? -