@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0675: (2015-12-17 )
MEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHYFYLIEESNMHSKYFAQIKEKKLPPLILTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPRVEASVLSYNKYLTKLYAKDLGVKALDYVLLNEKNRANALDLIGFNFPFIVKPSNAGSSLGVNVVKEEKELIYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKKGFCFSYVEEPNKQEFLDFKQKYLDFSRTKAPKANLSNALEEQLKENFKKLYNDLFDGAIIRCDFFVIENEVYLNEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQVKNSYLLQIQKNK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_6(2I8C)
DDL_STAAC
[Raw transfer]
1 PsiBlast_PDB 99.5896%-137 - C1 -2PVP - DDL_HELPY -
21 HHSearch 99.1896%-137 - C1 -2PVP - DDL_HELPY -
31 HHSearch 58.3426% -88 - C1 -3SE7 - ? -
25 HHSearch 58.0827% -88 - C1 -3TQT - DDL_COXBU -
2 PsiBlast_PDB 55.9427% -93 - C1 -1E4E - VANA_ENTFC -
3 PsiBlast_PDB 55.7328% -86 - C1 -2I87 - DDL_STAAC -
28 HHSearch 55.3526% -80 - C1 -1E4E - VANA_ENTFC -
23 HHSearch 55.0522% -81 - C1 -3E5N - ? -
13 PsiBlast_PDB 54.5828%-100 - C1 -2ZDG - DDL_THET8 -
26 HHSearch 54.2729% -94 * C1 *2FB9 - DDL_THET8 -
11 PsiBlast_PDB 53.5928% -94 - C1 -2YZM - DDL_THET8 -
8 PsiBlast_PDB 53.5829% -85 - C1 -4FU0 - ? -
5 PsiBlast_PDB 53.5828% -83 - C1 -2I80 - DDL_STAAC -
29 HHSearch 53.3324% -91 - C1 -2I87 - DDL_STAAC -
32 HHSearch 52.9427% -95 - C1 -3R5X - DDL_BACAN -
7 PsiBlast_PDB 52.9228% -81 - C1 -3SE7 - ? -
6 PsiBlast_PDB 52.7230% -87 - C1 -3TQT - DDL_COXBU -
12 PsiBlast_PDB 52.2428% -98 - C1 -2YZN - DDL_THET8 -
14 PsiBlast_PDB 51.9128% -88 - C1 -2ZDH - DDL_THET8 -
16 PsiBlast_PDB 51.6428% -91 - C1 -2FB9 - DDL_THET8 -