@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1054: (2015-12-20 )
MKRSSVFSFLVAFLLVVGCSHKMDNKTVAGDVSTKAVQTAPVTTEPAPEKEEPKQEPAPVVEEKPAIESGTIIASIYFDFDKYEIKESDQETLDEIVQKAKENHMQVLLEGNTDEFGSSEYNQALGVKRTLSVKNALVIKGVEKDMIKTISFGESKPKCVQKTRECYRENRRVDVKLVK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

API_A_2(4G4V)
?
[Raw transfer]




ALA_A_2(4G4W)
?
[Raw transfer]




DAL_A_2(4G4X)
?
[Raw transfer]




CHAIN_U_2(2AIZ)
PAL_HAEIN
[Raw transfer]

-

CHAIN_U_2(2AIZ)
PAL_HAEIN
[Raw transfer]

-

GOL_A_2(3LDT)
?
[Raw transfer]




104 HHSearch 91.6237% -43 - C4 -1R1M - OMP4_NEIMA -
11 PsiBlast_PDB 90.9633% -41 - C4 -1R1M - OMP4_NEIMA -
109 HHSearch 90.9536% -34 * C4 *2HQS - PAL_ECOLI -
94 Fugue 89.2735% -29 - C4 -1OAP - PAL_ECOLI -
21 PsiBlast_CBE 89.2034% -19 - C4 -4B5C - ? -
1 PsiBlast_PDB 88.8634% -21 - C4 -4B5C - ? -
26 PsiBlast_CBE 88.0538% -30 - C4 -2HQS - PAL_ECOLI -
23 PsiBlast_CBE 88.0138% -27 - C4 -2W8B - PAL_ECOLI -
27 PsiBlast_CBE 87.8938% -25 - C4 -2HQS - PAL_ECOLI -
4 PsiBlast_PDB 87.7438% -26 - C4 -2HQS - PAL_ECOLI -
22 PsiBlast_CBE 87.3934% -20 - C4 -4B5C - ? -
113 HHSearch 86.9339% -29 - C4 -2AIZ Error PAL_HAEIN
7 PsiBlast_PDB 86.2234% -30 - C4 -4G4W 3.1 ?
13 PsiBlast_PDB 86.1431% -48 - C4 -4RHA - ? -
25 PsiBlast_CBE 85.7438% -26 - C4 -2HQS - PAL_ECOLI -
8 PsiBlast_PDB 85.6334% -24 - C4 -4G4X 3.3 ?
24 PsiBlast_CBE 85.4638% -26 - C4 -2W8B - PAL_ECOLI -
5 PsiBlast_PDB 85.4538% -20 - C4 -2W8B - PAL_ECOLI -
10 PsiBlast_PDB 85.3338% -26 - C4 -4PWT - ? -
3 PsiBlast_PDB 85.2138% -21 - C4 -1OAP - PAL_ECOLI -
6 PsiBlast_PDB 84.7134% -28 - C4 -4G4V 4.3 ?
2 PsiBlast_PDB 80.5242% -3 - C4 -2AIZ Error PAL_HAEIN