@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0271: (2016-03-14 )
MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIPGTTFKGTNGDVAVDHYHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLQFYDNLIDELLKYDIEPLVTLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVKYWVSLNEQNIFVGMGYGQALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIGPSFAYTPHYPIDTDPKNVQAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIEDGDMELLASAKPDFMGVNYYQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKKVVNPFVKTTNWDWTIDPKGLQIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRIDYLSAHATAIRDAISDGVDMLGYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTRIPKKSYYWYKQVIETNGADL

Atome Classification :

(72 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GI1_B_5(2J7D)
BGLA_THEMA
[Raw transfer]




GOX_A_7(2J78)
BGLA_THEMA
[Raw transfer]




GIM_B_7(2CES)
BGLA_THEMA
[Raw transfer]




GOX_A_7(2J78)
BGLA_THEMA
[Raw transfer]




NOY_B_6(2J75)
BGLA_THEMA
[Raw transfer]




GI4_B_5(2J7G)
BGLA_THEMA
[Raw transfer]




NTZ_B_5(2J7B)
BGLA_THEMA
[Raw transfer]




BG6_B_7(4F66)
?
[Raw transfer]




TCB_A_3(4PTV)
?
[Raw transfer]




TCB_B_6(4PTV)
?
[Raw transfer]




CTS_B_6(2CBU)
BGLA_THEMA
[Raw transfer]




NOJ_A_3(1OIM)
BGLA_THEMA
[Raw transfer]




CGB_B_5(2CBV)
BGLA_THEMA
[Raw transfer]




GI2_B_5(2J7E)
BGLA_THEMA
[Raw transfer]




GOX_B_9(2J78)
BGLA_THEMA
[Raw transfer]




BG6_A_3(4F66)
?
[Raw transfer]




GI4_A_3(2J7G)
BGLA_THEMA
[Raw transfer]




IFL_B_4(1UZ1)
BGLA_THEMA
[Raw transfer]




NOY_A_4(2J75)
BGLA_THEMA
[Raw transfer]




OXZ_A_3(1W3J)
BGLA_THEMA
[Raw transfer]




BGC_A_2(2E9L)
GBA3_HUMAN
[Raw transfer]




GTL_B_5(2J79)
BGLA_THEMA
[Raw transfer]




BGC_A_2(4HZ8)
?
[Raw transfer]




BGC_A_2(4HZ7)
?
[Raw transfer]




OXZ_B_4(1W3J)
BGLA_THEMA
[Raw transfer]




NOJ_B_4(1OIM)
BGLA_THEMA
[Raw transfer]




GIM_A_4(2CES)
BGLA_THEMA
[Raw transfer]




NOJ_B_5(2J77)
BGLA_THEMA
[Raw transfer]




AZF_B_7(2J7H)
BGLA_THEMA
[Raw transfer]




CTS_A_3(2CBU)
BGLA_THEMA
[Raw transfer]




IFM_A_3(1OIF)
BGLA_THEMA
[Raw transfer]




IFM_B_4(1OIF)
BGLA_THEMA
[Raw transfer]




GOL_S_19(2DGA)
HGL1B_WHEAT
[Raw transfer]




GTL_A_3(2J79)
BGLA_THEMA
[Raw transfer]




GOL_S_19(2DGA)
HGL1B_WHEAT
[Raw transfer]




CGB_A_3(2CBV)
BGLA_THEMA
[Raw transfer]




GOL_M_24(1E4M)
MYRA_SINAL
[Raw transfer]




BGC_A_3(4PTX)
?
[Raw transfer]




BTB_A_2(3VII)
?
[Raw transfer]




IFL_A_3(1UZ1)
BGLA_THEMA
[Raw transfer]




GLC_A_2(3WBE)
BGL06_ORYSJ
[Raw transfer]




GOL_A_3(4IPL)
?
[Raw transfer]




YLL_B_6(2JAL)
BGLA_THEMA
[Raw transfer]




SRT_A_24(3CMJ)
?
[Raw transfer]




BGC_B_5(4PTX)
?
[Raw transfer]




NCW_B_7(2VRJ)
BGLA_THEMA
[Raw transfer]




G2F_A_9(1E4I)
BGLA_PAEPO
[Raw transfer]




GLC_A_2(3WBA)
BGL06_ORYSJ
[Raw transfer]




NCW_A_3(2VRJ)
BGLA_THEMA
[Raw transfer]




G2F_A_3(1OIN)
BGLA_THEMA
[Raw transfer]




G2F_A_9(1E4I)
BGLA_PAEPO
[Raw transfer]




G2F_A_3(4PTW)
?
[Raw transfer]




TRS_A_2(3W53)
?
[Raw transfer]




G2F_A_2(3AIR)
HGL1B_WHEAT
[Raw transfer]




G2F_B_4(1OIN)
BGLA_THEMA
[Raw transfer]




TRS_A_2(3W53)
?
[Raw transfer]




G2F_B_5(4PTW)
?
[Raw transfer]




G2F_A_2(3GNR)
BGL06_ORYSJ
[Raw transfer]




G2F_A_3(3AIW)
HGGL_SECCE
[Raw transfer]




G2F_A_9(1UYQ)
BGLA_PAEPO
[Raw transfer]




TRS_A_2(3GNO)
BGL06_ORYSJ
[Raw transfer]




107 HHSearch 94.7142% -75 - C2 -2XHY - BGLA_ECOLI -
25 PsiBlast_CBE 93.5838% -76 - C2 -2XHY - BGLA_ECOLI -
28 PsiBlast_CBE 93.2840% -75 - C2 -4GPN - ? -
4 PsiBlast_PDB 92.9140% -76 - C2 -4F79 - ? -
26 PsiBlast_CBE 92.7038% -74 - C2 -2XHY - BGLA_ECOLI -
5 PsiBlast_PDB 92.6640% -75 - C2 -4GPN - ? -
24 PsiBlast_CBE 92.2638% -75 - C2 -2XHY - BGLA_ECOLI -
27 PsiBlast_CBE 92.2540% -73 - C2 -4F66 5.1 ?
2 PsiBlast_PDB 92.1838% -74 - C2 -2XHY - BGLA_ECOLI -
3 PsiBlast_PDB 92.1440% -74 - C2 -4F66 6.0 ?
6 PsiBlast_PDB 92.0440% -74 - C2 -3PN8 - ? -
118 HHSearch 91.4540% -78 * C2 *2J78 4.6 BGLA_THEMA
18 PsiBlast_PDB 91.2239% -72 - C2 -4HZ8 4.0 ?
17 PsiBlast_PDB 90.7739% -73 - C2 -4HZ7 4.0 ?
16 PsiBlast_PDB 90.6739% -72 - C2 -4HZ6 - ? -
8 PsiBlast_PDB 90.2538% -79 - C2 -4IPN - ? -
7 PsiBlast_PDB 90.2538% -79 - C2 -4IPL 2.6 ?
12 PsiBlast_PDB 90.1839% -73 - C2 -3CMJ 4.6 ?
119 HHSearch 89.9537% -75 - C2 -1E4I 2.4 BGLA_PAEPO
73 PsiBlast_CBE 89.5338% -72 - C2 -2J75 4.2 BGLA_THEMA
61 PsiBlast_CBE 89.5238% -71 - C2 -2J7G 5.4 BGLA_THEMA
58 PsiBlast_CBE 89.3838% -75 - C2 -2VRJ 5.4 BGLA_THEMA
70 PsiBlast_CBE 89.2338% -72 - C2 -2J78 4.5 BGLA_THEMA
39 PsiBlast_CBE 88.8938% -75 - C2 -4PTX 3.8 ?
67 PsiBlast_CBE 88.8038% -73 - C2 -2J79 4.1 BGLA_THEMA
62 PsiBlast_CBE 88.7438% -74 - C2 -2J7G 5.2 BGLA_THEMA
66 PsiBlast_CBE 88.6938% -72 - C2 -2J7B 4.6 BGLA_THEMA
90 PsiBlast_CBE 88.6238% -69 - C2 -1OIF 4.0 BGLA_THEMA
89 PsiBlast_CBE 88.5938% -71 - C2 -1OIF 3.8 BGLA_THEMA
86 PsiBlast_CBE 88.5238% -70 - C2 -1OIN 3.2 BGLA_THEMA
72 PsiBlast_CBE 88.5138% -71 - C2 -2J75 4.5 BGLA_THEMA
69 PsiBlast_CBE 88.5038% -72 - C2 -2J78 4.4 BGLA_THEMA
81 PsiBlast_CBE 88.4638% -72 - C2 -1W3J 3.8 BGLA_THEMA
80 PsiBlast_CBE 88.4638% -73 - C2 -2CBU 4.6 BGLA_THEMA
87 PsiBlast_CBE 88.4538% -71 - C2 -1OIM 4.2 BGLA_THEMA
40 PsiBlast_CBE 88.4238% -74 - C2 -4PTX 3.9 ?
78 PsiBlast_CBE 88.3438% -72 - C2 -2CBV 3.8 BGLA_THEMA
68 PsiBlast_CBE 88.3338% -72 - C2 -2J79 4.0 BGLA_THEMA
43 PsiBlast_CBE 88.3338% -73 - C2 -4PTV 4.3 ?
77 PsiBlast_CBE 88.2838% -69 - C2 -2CBV 4.2 BGLA_THEMA
85 PsiBlast_CBE 88.2238% -72 - C2 -1OIN 2.7 BGLA_THEMA
84 PsiBlast_CBE 88.2238% -72 - C2 -1UZ1 3.8 BGLA_THEMA
64 PsiBlast_CBE 88.1238% -70 - C2 -2J7D 5.7 BGLA_THEMA
88 PsiBlast_CBE 88.0938% -73 - C2 -1OIM 4.5 BGLA_THEMA
79 PsiBlast_CBE 88.0738% -71 - C2 -2CBU 4.9 BGLA_THEMA
75 PsiBlast_CBE 88.0238% -71 - C2 -2CES 4.5 BGLA_THEMA
41 PsiBlast_CBE 88.0138% -74 - C2 -4PTW 3.2 ?
83 PsiBlast_CBE 87.8638% -71 - C2 -1UZ1 4.1 BGLA_THEMA
63 PsiBlast_CBE 87.7438% -70 - C2 -2J7E 6.0 BGLA_THEMA
42 PsiBlast_CBE 87.6238% -73 - C2 -4PTW 2.9 ?
57 PsiBlast_CBE 87.4038% -70 - C2 -2VRJ 5.6 BGLA_THEMA
82 PsiBlast_CBE 87.3638% -69 - C2 -1W3J 3.8 BGLA_THEMA
60 PsiBlast_CBE 87.3438% -71 - C2 -2J7H 3.8 BGLA_THEMA
9 PsiBlast_PDB 87.3436% -72 - C2 -1UYQ 2.4 BGLA_PAEPO
76 PsiBlast_CBE 87.2038% -71 - C2 -2CES 5.0 BGLA_THEMA
71 PsiBlast_CBE 87.1538% -70 - C2 -2J77 4.3 BGLA_THEMA
108 HHSearch 87.1138% -68 - C2 -3W53 3.1 ?
59 PsiBlast_CBE 86.9538% -70 - C2 -2JAL 2.6 BGLA_THEMA
44 PsiBlast_CBE 86.9238% -73 - C2 -4PTV 4.5 ?
11 PsiBlast_PDB 86.7035% -71 - C2 -1E4I 2.4 BGLA_PAEPO
91 PsiBlast_CBE 85.7839% -58 - C2 -3W53 3.1 ?
101 HHSearch 85.0537% -67 - C2 -2DGA 2.9 HGL1B_WHEAT
92 PsiBlast_CBE 84.0535% -66 - C2 -3GNR 2.4 BGL06_ORYSJ
94 PsiBlast_CBE 83.8035% -66 - C2 -3GNO 2.0 BGL06_ORYSJ
95 PsiBlast_CBE 83.5435% -67 - C2 -3WBE 3.8 BGL06_ORYSJ
99 PsiBlast_CBE 82.8236% -62 - C2 -2DGA 2.9 HGL1B_WHEAT
96 PsiBlast_CBE 82.4835% -66 - C2 -3WBA 3.1 BGL06_ORYSJ
97 PsiBlast_CBE 82.4036% -62 - C2 -3AIR 2.3 HGL1B_WHEAT
100 PsiBlast_CBE 81.8336% -62 - C2 -3AIW 3.1 HGGL_SECCE
102 HHSearch 81.4531% -76 - C2 -1E4M 3.4 MYRA_SINAL
114 HHSearch 81.4033% -73 - C2 -2E9L 2.4 GBA3_HUMAN
116 HHSearch 80.3033% -68 - C2 -3VII 3.3 ?