@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1953: (2016-03-30 )
MSLEKVNEAVAKIRESYTGTPKIGLILGSGLGVLADEVNQPIKLSYSEIPHFPVSTVEGHAGQFVFGELENKEVVAMQGRFHFYEGYSMQDVTFPVRVMKELGVEVLIVTNAAGGVNELYSAGDLMLISDHINFTGTSPLIGPNDEHFGPRFPDMSEAYNLALRVDARLIAQELNLTIREGVYAGFSGPTYETPAEIQMMRTLGADAVGMSTVPEVIIANHAGLRVLGISCITNMAAGILDQPLSHTEVIETTDQVRSTFLQYVKAIVAKIS

Atome Classification :

(80 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P1G_A_5(2AI1)
PNPH_BOVIN
[Raw transfer]




P1D_A_5(2AI2)
PNPH_BOVIN
[Raw transfer]




NOS_G_7(1A9S)
PNPH_BOVIN
[Raw transfer]




9DI_G_7(1A9P)
PNPH_BOVIN
[Raw transfer]




P2G_A_5(2AI3)
PNPH_BOVIN
[Raw transfer]




IMH_M_13(1RT9)
PNPH_HUMAN
[Raw transfer]




IMG_A_4(1B8N)
PNPH_BOVIN
[Raw transfer]




IMH_A_4(1B8O)
PNPH_BOVIN
[Raw transfer]




NOS_E_5(1RCT)
PNPH_HUMAN
[Raw transfer]




GMP_C_11(3IEX)
?
[Raw transfer]




GMP_A_4(3IEX)
?
[Raw transfer]




IMH_M_13(1RR6)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(1G2O)
PUNA_MYCTU
[Raw transfer]




DIH_M_13(1RSZ)
PNPH_HUMAN
[Raw transfer]




DIH_J_10(2A0X)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(2OC9)
PNPH_HUMAN
[Raw transfer]




GMP_M_13(1RFG)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(2OC4)
PNPH_HUMAN
[Raw transfer]




HA1_A_4(1V48)
PNPH_BOVIN
[Raw transfer]




IM5_C_10(4EB8)
PNPH_HUMAN
[Raw transfer]




22A_A_2(3K8Q)
PNPH_HUMAN
[Raw transfer]




DIH_J_10(2A0W)
PNPH_HUMAN
[Raw transfer]




DIH_J_10(2A0Y)
PNPH_HUMAN
[Raw transfer]




DIH_A_5(3BGS)
PNPH_HUMAN
[Raw transfer]




IM5_B_7(4EB8)
PNPH_HUMAN
[Raw transfer]




DIH_A_8(2P4S)
?
[Raw transfer]




3DG_M_13(1V45)
PNPH_HUMAN
[Raw transfer]




IMH_D_4(2ON6)
PNPH_HUMAN
[Raw transfer]




R1P_C_8(3FB1)
?
[Raw transfer]




IMH_E_3(2Q7O)
PNPH_HUMAN
[Raw transfer]




IMH_M_13(1PF7)
PNPH_HUMAN
[Raw transfer]




R1P_D_4(1A9T)
PNPH_BOVIN
[Raw transfer]




MSG_E_5(1YRY)
PNPH_HUMAN
[Raw transfer]




IM5_A_5(4EB8)
PNPH_HUMAN
[Raw transfer]




AC2_M_13(1PWY)
PNPH_HUMAN
[Raw transfer]




2DI_M_13(1V3Q)
PNPH_HUMAN
[Raw transfer]




GU7_A_5(1FXU)
PNPH_BOVIN
[Raw transfer]




HPA_G_7(1A9R)
PNPH_BOVIN
[Raw transfer]




HPA_A_4(3FNQ)
?
[Raw transfer]




GUN_P_16(1V2H)
PNPH_HUMAN
[Raw transfer]




HPA_A_2(3LBA)
?
[Raw transfer]




HPA_G_7(1A9Q)
PNPH_BOVIN
[Raw transfer]




HPA_B_8(3FNQ)
?
[Raw transfer]




HPA_C_10(3FNQ)
?
[Raw transfer]




HPA_A_4(1VFN)
PNPH_BOVIN
[Raw transfer]




AZG_P_16(1V41)
PNPH_HUMAN
[Raw transfer]




XAN_A_2(3ODG)
?
[Raw transfer]




XAN_A_2(3ODG)
?
[Raw transfer]




GUN_J_10(1ULB)
PNPH_HUMAN
[Raw transfer]




7DG_A_5(3INY)
PNPH_HUMAN
[Raw transfer]




2FD_B_5(3GGS)
PNPH_HUMAN
[Raw transfer]




BTY_A_4(2QPL)
PNPH_BOVIN
[Raw transfer]




2FD_C_6(3GGS)
PNPH_HUMAN
[Raw transfer]




2FD_A_4(3GGS)
PNPH_HUMAN
[Raw transfer]




TRS_B_8(3KHS)
?
[Raw transfer]




9D9_B_7(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_C_9(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




TRS_D_12(3KHS)
?
[Raw transfer]




NDS_G_7(1TCV)
?
[Raw transfer]




TRS_C_10(3KHS)
?
[Raw transfer]




A2F_B_5(3GB9)
PNPH_HUMAN
[Raw transfer]




D1V_A_5(3D1V)
PNPH_HUMAN
[Raw transfer]




A2F_A_4(3GB9)
PNPH_HUMAN
[Raw transfer]




A2F_C_6(3GB9)
PNPH_HUMAN
[Raw transfer]




2 PsiBlast_PDB 94.9853%-122 - C4 -3LBA 3.5 ?
111 HHSearch 92.9049%-112 * C4 *3FUC 4.3 PNPH_BOVIN
39 PsiBlast_CBE 92.5850%-114 - C4 -3PHB - PNPH_HUMAN -
110 HHSearch 92.5354%-127 - C4 -3LA8 - ? -
1 PsiBlast_PDB 92.3653%-129 - C4 -3LA8 - ? -
82 PsiBlast_CBE 92.3050%-112 - C4 -4EB8 5.0 PNPH_HUMAN
53 PsiBlast_CBE 92.0650%-115 - C4 -3K8O - PNPH_HUMAN -
79 PsiBlast_CBE 91.9950%-116 - C4 -4ECE - PNPH_HUMAN -
78 PsiBlast_CBE 91.9550%-114 - C4 -4ECE - PNPH_HUMAN -
52 PsiBlast_CBE 91.8150%-113 - C4 -3K8O - PNPH_HUMAN -
116 HHSearch 91.7944%-114 - C4 -3ODG 3.3 ?
50 PsiBlast_CBE 91.7750%-117 - C4 -3K8O - PNPH_HUMAN -
51 PsiBlast_CBE 91.5850%-119 - C4 -3K8O - PNPH_HUMAN -
81 PsiBlast_CBE 91.5650%-112 - C4 -4EB8 5.4 PNPH_HUMAN
73 PsiBlast_CBE 91.5650%-121 - C4 -4GKA - PNPH_HUMAN -
35 PsiBlast_CBE 91.5450%-115 - C4 -3PHB - PNPH_HUMAN -
76 PsiBlast_CBE 91.5350%-115 - C4 -4ECE - PNPH_HUMAN -
70 PsiBlast_CBE 91.5350%-115 - C4 -2A0Y 4.7 PNPH_HUMAN
55 PsiBlast_CBE 91.4650%-114 - C4 -3K8O - PNPH_HUMAN -
77 PsiBlast_CBE 91.2150%-118 - C4 -4ECE - PNPH_HUMAN -
18 PsiBlast_PDB 91.0651%-121 - C4 -2AI3 7.0 PNPH_BOVIN
6 PsiBlast_PDB 90.8951%-114 - C4 -1A9T 4.6 PNPH_BOVIN
16 PsiBlast_PDB 90.8651%-122 - C4 -2AI1 8.5 PNPH_BOVIN
20 PsiBlast_PDB 90.6751%-112 - C4 -1B8O 6.1 PNPH_BOVIN
83 PsiBlast_CBE 90.4950%-110 - C4 -4EB8 3.4 PNPH_HUMAN
3 PsiBlast_PDB 90.3251%-115 - C4 -1FXU 4.6 PNPH_BOVIN
4 PsiBlast_PDB 90.3151%-115 - C4 -1A9Q 3.1 PNPH_BOVIN
19 PsiBlast_PDB 90.2851%-114 - C4 -1B8N 6.3 PNPH_BOVIN
58 PsiBlast_CBE 90.2750%-115 - C4 -3BGS 3.8 PNPH_HUMAN
5 PsiBlast_PDB 90.0351%-116 - C4 -1A9R 3.3 PNPH_BOVIN
68 PsiBlast_CBE 89.9550%-113 - C4 -2A0X 3.4 PNPH_HUMAN
33 PsiBlast_CBE 89.9251%-120 - C4 -3FUC 4.3 PNPH_BOVIN
11 PsiBlast_PDB 89.9151%-113 - C4 -1A9S 5.8 PNPH_BOVIN
69 PsiBlast_CBE 89.8650%-112 - C4 -2OC4 4.1 PNPH_HUMAN
114 HHSearch 89.8445%-104 - C4 -2P4S 4.9 ?
93 PsiBlast_CBE 89.4844%-119 - C4 -3ODG 3.3 ?
65 PsiBlast_CBE 89.4250%-113 - C4 -1RR6 4.0 PNPH_HUMAN
17 PsiBlast_PDB 89.3351%-116 - C4 -2AI2 7.7 PNPH_BOVIN
72 PsiBlast_CBE 89.2650%-110 - C4 -2A0W 4.6 PNPH_HUMAN
63 PsiBlast_CBE 89.2050%-112 - C4 -1RT9 4.3 PNPH_HUMAN
64 PsiBlast_CBE 89.1550%-113 - C4 -1RSZ 4.2 PNPH_HUMAN
32 PsiBlast_CBE 89.1451%-119 - C4 -3FUC 4.5 PNPH_BOVIN
10 PsiBlast_PDB 89.0651%-108 - C4 -1A9P 5.5 PNPH_BOVIN
14 PsiBlast_PDB 88.7451%-120 - C4 -1VFN 3.2 PNPH_BOVIN
67 PsiBlast_CBE 88.6850%-118 - C4 -2ON6 4.0 PNPH_HUMAN
61 PsiBlast_CBE 88.6850%-113 - C4 -1ULB 4.1 PNPH_HUMAN
31 PsiBlast_CBE 88.6751%-117 - C4 -3FUC 4.5 PNPH_BOVIN
15 PsiBlast_PDB 88.5851%-126 - C4 -1V48 7.1 PNPH_BOVIN
97 PsiBlast_CBE 88.5243%-109 - C4 -3FNQ 2.2 ?
85 PsiBlast_CBE 88.3749%-119 - C4 -3GGS 4.0 PNPH_HUMAN
100 PsiBlast_CBE 88.3143%-108 - C4 -3FB1 4.9 ?
60 PsiBlast_CBE 88.2250%-111 - C4 -1YRY 3.6 PNPH_HUMAN
94 PsiBlast_CBE 88.1443%-107 - C4 -3IEX 5.7 ?
92 PsiBlast_CBE 88.0943%-121 - C4 -3KHS 2.5 ?
43 PsiBlast_CBE 87.9250%-113 - C4 -1V3Q 4.1 PNPH_HUMAN
49 PsiBlast_CBE 87.9150%-115 - C4 -3K8Q 4.1 PNPH_HUMAN
41 PsiBlast_CBE 87.8950%-114 - C4 -1V45 4.0 PNPH_HUMAN
86 PsiBlast_CBE 87.7749%-116 - C4 -3GGS 4.0 PNPH_HUMAN
42 PsiBlast_CBE 87.7550%-111 - C4 -1V41 3.4 PNPH_HUMAN
57 PsiBlast_CBE 87.6150%-110 - C4 -3D1V 2.9 PNPH_HUMAN
47 PsiBlast_CBE 87.6150%-110 - C4 -1PWY 3.9 PNPH_HUMAN
99 PsiBlast_CBE 87.3743%-112 - C4 -3FNQ 3.9 ?
45 PsiBlast_CBE 87.2550%-114 - C4 -1RFG 4.0 PNPH_HUMAN
46 PsiBlast_CBE 87.1950%-113 - C4 -1RCT 3.7 PNPH_HUMAN
98 PsiBlast_CBE 86.9543%-115 - C4 -3FNQ 3.0 ?
66 PsiBlast_CBE 86.9550%-109 - C4 -1PF7 3.3 PNPH_HUMAN
40 PsiBlast_CBE 86.8751%-118 - C4 -2QPL 3.6 PNPH_BOVIN
115 HHSearch 86.8645%-118 - C4 -1TCV 2.8 ?
44 PsiBlast_CBE 86.8050%-112 - C4 -1V2H 3.6 PNPH_HUMAN
89 PsiBlast_CBE 86.6449%-114 - C4 -3GB9 3.5 PNPH_HUMAN
71 PsiBlast_CBE 86.5550%-116 - C4 -2OC9 3.7 PNPH_HUMAN
90 PsiBlast_CBE 86.4943%-122 - C4 -3KHS 2.5 ?
59 PsiBlast_CBE 86.2650%-109 - C4 -2Q7O 4.5 PNPH_HUMAN
56 PsiBlast_CBE 86.2550%-109 - C4 -3INY 3.7 PNPH_HUMAN
87 PsiBlast_CBE 86.0449%-121 - C4 -3GB9 3.7 PNPH_HUMAN
96 PsiBlast_CBE 85.9543%-111 - C4 -3IEX 5.7 ?
84 PsiBlast_CBE 85.6149%-120 - C4 -3GGS 4.7 PNPH_HUMAN
88 PsiBlast_CBE 84.6049%-119 - C4 -3GB9 4.1 PNPH_HUMAN
91 PsiBlast_CBE 84.4643%-118 - C4 -3KHS 2.4 ?
117 HHSearch 80.6541%-115 - C4 -1G2O 6.1 PUNA_MYCTU