@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu01100: (2016-06-02 )
MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRAQGRSKYGTKKPKAK

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_W_22(4B3T)
RS12_THET8
[Raw transfer]

-

NACID_W_22(4B3R)
RS12_THET8
[Raw transfer]

-

NACID_X_2(2VQE)
RS12_THET8
[Raw transfer]

-

CHAIN_X_2(2UU9)
RS12_THET8
[Raw transfer]

-

NACID_W_22(4AQY)
RS12_THET8
[Raw transfer]

-

CHAIN_Z_2(1N34)
RS12_THET8
[Raw transfer]

-

NACID_W_22(4B3M)
RS12_THET8
[Raw transfer]

-

NACID_X_2(2VQE)
RS12_THET8
[Raw transfer]

-

CHAIN_W_22(3T1Y)
RS12_THET8
[Raw transfer]

-

NACID_X_2(2UUA)
RS12_THET8
[Raw transfer]

-

NACID_X_2(2UUB)
RS12_THET8
[Raw transfer]

-

NACID_X_2(2UUC)
RS12_THET8
[Raw transfer]

-

CHAIN_X_22(4JV5)
RS12_THET8
[Raw transfer]

-

CHAIN_X_22(4K0K)
RS12_THET8
[Raw transfer]

-

71 Fugue 89.0875% -59 - C4 -1FJG - RS12_THET8 -
81 HHSearch 88.2675% -60 * C4 *2VQE Error RS12_THET8
1 PsiBlast_PDB 87.3569% -72 - C4 -4OX9 - RS12_THET8 -
12 PsiBlast_PDB 87.1768% -72 - C4 -4K0K 3.6 RS12_THET8
2 PsiBlast_PDB 86.9768% -79 - C4 -3DEG - RS12_ECOLI -
11 PsiBlast_PDB 86.8468% -60 - C4 -3J0E - RS12_ECOLI -
9 PsiBlast_PDB 86.6168% -60 - C4 -4ADV - RS12_ECOLI -
18 PsiBlast_PDB 86.4868% -61 - C4 -4GKK - RS12_THET8 -
17 PsiBlast_PDB 86.2668% -58 - C4 -4GKJ - RS12_THET8 -
22 PsiBlast_CBE 86.2468% -72 - C4 -4JV5 3.7 RS12_THET8
10 PsiBlast_PDB 86.1968% -60 - C4 -3J0D - RS12_ECOLI -
43 PsiBlast_CBE 86.1467% -72 - C4 -1N34 Error RS12_THET8
8 PsiBlast_PDB 86.1268% -60 - C4 -4A2I - RS12_ECOLI -
20 PsiBlast_PDB 86.0668% -69 - C4 -4KHP - RS12_THET8 -
21 PsiBlast_CBE 85.4168% -61 - C4 -4JYA - RS12_THET8 -
27 PsiBlast_CBE 85.3568% -58 - C4 -3T1Y Error RS12_THET8
23 PsiBlast_CBE 85.1368% -71 - C4 -4B3T Error RS12_THET8
25 PsiBlast_CBE 85.0768% -72 - C4 -4B3R Error RS12_THET8
26 PsiBlast_CBE 84.9068% -73 - C4 -4B3M Error RS12_THET8
7 PsiBlast_PDB 84.8168% -69 - C4 -2YKR - RS12_ECOLI -
37 PsiBlast_CBE 84.1367% -67 - C4 -2UUA Error RS12_THET8
30 PsiBlast_CBE 83.8967% -71 - C4 -4AQY Error RS12_THET8
36 PsiBlast_CBE 83.5767% -68 - C4 -2UUB Error RS12_THET8
32 PsiBlast_CBE 83.4567% -62 - C4 -2VQE Error RS12_THET8
35 PsiBlast_CBE 83.3567% -60 - C4 -2UUC Error RS12_THET8
38 PsiBlast_CBE 82.8267% -61 - C4 -2UU9 Error RS12_THET8