@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu25640: (2016-07-10 )
MKKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIPPHKQNEDYTDSFHRVEMLKLAIQSNPSFKLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHVETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLYES

Atome Classification :

(50 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_A_4(3MLB)
NADD_BACAC
[Raw transfer]




FMT_B_10(3MLA)
NADD_BACAC
[Raw transfer]




DND_H_8(1KAQ)
NADD_BACSU
[Raw transfer]




DND_I_9(1KAQ)
NADD_BACSU
[Raw transfer]




DND_L_12(1KAQ)
NADD_BACSU
[Raw transfer]




NXX_A_8(2QTR)
NADD_BACAC
[Raw transfer]




NXX_C_10(2QTR)
NADD_BACAC
[Raw transfer]




DND_B_7(3E27)
?
[Raw transfer]




NXX_A_8(2QTR)
NADD_BACAC
[Raw transfer]




DND_A_5(3E27)
?
[Raw transfer]




DND_D_11(3E27)
?
[Raw transfer]




NXX_B_9(2QTR)
NADD_BACAC
[Raw transfer]




DND_C_9(3E27)
?
[Raw transfer]




NAP_A_3(4YBR)
NADD_MYCTU
[Raw transfer]




NAP_A_3(4YBR)
NADD_MYCTU
[Raw transfer]




DND_J_10(1KAQ)
NADD_BACSU
[Raw transfer]




NAP_A_3(4YMI)
?
[Raw transfer]




NAP_A_3(4YMI)
?
[Raw transfer]




DND_K_11(1KAQ)
NADD_BACSU
[Raw transfer]




NAP_A_3(4S1O)
?
[Raw transfer]




NAP_B_5(4S1O)
?
[Raw transfer]




DND_G_7(1KAQ)
NADD_BACSU
[Raw transfer]




NAD_D_4(1K4M)
NADD_ECOLI
[Raw transfer]




NAP_B_6(4YMI)
?
[Raw transfer]




NCN_B_5(2QTN)
?
[Raw transfer]




GOL_B_8(2QTM)
?
[Raw transfer]




GOL_A_9(2QTN)
?
[Raw transfer]




GOL_A_6(2QTM)
?
[Raw transfer]




LJZ_A_5(3MLB)
NADD_BACAC
[Raw transfer]




LJZ_A_5(3MLB)
NADD_BACAC
[Raw transfer]




JJZ_A_3(3MLA)
NADD_BACAC
[Raw transfer]




ATP_A_4(1YUN)
NADD_PSEAE
[Raw transfer]




NCN_B_8(1YUM)
NADD_PSEAE
[Raw transfer]




ATP_B_5(1YUN)
NADD_PSEAE
[Raw transfer]




NCN_D_12(1YUM)
NADD_PSEAE
[Raw transfer]




NCN_C_10(1YUM)
NADD_PSEAE
[Raw transfer]




NCN_A_6(1YUM)
NADD_PSEAE
[Raw transfer]




CIT_C_9(1YUM)
NADD_PSEAE
[Raw transfer]




NCN_A_6(1YUM)
NADD_PSEAE
[Raw transfer]




DZ9_A_3(3HFJ)
?
[Raw transfer]




CIT_A_5(1YUM)
NADD_PSEAE
[Raw transfer]




JJZ_A_3(3MLA)
NADD_BACAC
[Raw transfer]




DZ9_A_3(3HFJ)
?
[Raw transfer]




DMS_B_9(3MLA)
NADD_BACAC
[Raw transfer]




2 PsiBlast_PDB 91.71100%-127 - C1 -1KAQ 10.5 NADD_BACSU
23 PsiBlast_CBE 91.39100%-135 - C1 -1KAQ 9.9 NADD_BACSU
24 PsiBlast_CBE 91.04100%-132 - C1 -1KAQ 9.8 NADD_BACSU
25 PsiBlast_CBE 89.57100%-124 - C1 -1KAQ 10.6 NADD_BACSU
22 PsiBlast_CBE 88.36100%-149 - C1 -1KAQ 8.4 NADD_BACSU
1 PsiBlast_PDB 87.77100%-150 - C1 -1KAM - NADD_BACSU -
21 PsiBlast_CBE 87.50100%-159 - C1 -1KAQ 6.9 NADD_BACSU
101 Fugue 86.6298%-148 - C1 -1KAM - NADD_BACSU -
36 PsiBlast_CBE 84.3256%-174 - C1 -3MMX - NADD_BACAC -
40 PsiBlast_CBE 83.8956%-170 - C1 -3MMX - NADD_BACAC -
10 PsiBlast_PDB 83.4256%-166 - C1 -3MMX - NADD_BACAC -
6 PsiBlast_PDB 83.3656%-165 - C1 -3DV2 - ? -
8 PsiBlast_PDB 83.3456%-158 - C1 -3MLA 4.7 NADD_BACAC
43 PsiBlast_CBE 83.2556%-158 - C1 -3HFJ 5.3 ?
38 PsiBlast_CBE 83.2056%-167 - C1 -3MMX - NADD_BACAC -
39 PsiBlast_CBE 83.1656%-170 - C1 -3MMX - NADD_BACAC -
32 PsiBlast_CBE 83.0456%-165 - C1 -3DV2 - ? -
3 PsiBlast_PDB 83.0056%-164 - C1 -2QTM 2.7 ?
31 PsiBlast_CBE 82.6856%-158 - C1 -3DV2 - ? -
34 PsiBlast_CBE 82.2156%-177 - C1 -3MMX - NADD_BACAC -
41 PsiBlast_CBE 82.1656%-160 - C1 -3MLB 5.4 NADD_BACAC
7 PsiBlast_PDB 82.0356%-154 - C1 -3HFJ 5.1 ?
9 PsiBlast_PDB 81.8456%-159 - C1 -3MLB 5.6 NADD_BACAC
42 PsiBlast_CBE 81.1856%-161 - C1 -3MLA 5.5 NADD_BACAC
44 PsiBlast_CBE 80.4756%-141 - C1 -2QTR 10.8 NADD_BACAC
30 PsiBlast_CBE 80.2956%-146 - C1 -2QTM 2.0 ?
11 PsiBlast_PDB 79.6256%-146 - C1 -2QTR 10.5 NADD_BACAC
29 PsiBlast_CBE 79.5356%-145 - C1 -2QTN 4.7 ?
28 PsiBlast_CBE 79.4256%-143 - C1 -3E27 9.0 ?
45 PsiBlast_CBE 79.3756%-139 - C1 -2QTR 8.6 NADD_BACAC
27 PsiBlast_CBE 79.0756%-143 - C1 -3E27 7.6 ?
5 PsiBlast_PDB 78.9556%-138 - C1 -3E27 8.7 ?
26 PsiBlast_CBE 78.7756%-139 - C1 -3E27 9.0 ?
4 PsiBlast_PDB 78.3456%-148 - C1 -2QTN 2.1 ?
87 HHSearch 72.1156% -82 - C1 -2QTR 10.5 NADD_BACAC
86 HHSearch 70.2240%-148 - C1 -4YMI 5.7 ?
12 PsiBlast_PDB 69.5237%-148 - C1 -4YMI 5.7 ?
46 PsiBlast_CBE 67.6037%-102 - C1 -4YMI 6.0 ?
49 PsiBlast_CBE 65.7036%-151 - C1 -4S1O 6.5 ?
81 HHSearch 64.4338% -82 - C1 -4YBR 6.1 NADD_MYCTU
14 PsiBlast_PDB 63.4036% -99 - C1 -4S1O 7.7 ?
15 PsiBlast_PDB 63.1436% -86 - C1 -4YBR 6.1 NADD_MYCTU
85 HHSearch 61.9136% -51 - C1 -1K4M 9.6 NADD_ECOLI
60 PsiBlast_CBE 61.7531% -68 - C1 -1YUM 4.0 NADD_PSEAE
59 PsiBlast_CBE 60.4131% -66 - C1 -1YUM 3.2 NADD_PSEAE
57 PsiBlast_CBE 58.9831% -63 - C1 -1YUN 2.4 NADD_PSEAE
20 PsiBlast_PDB 58.9331% -60 - C1 -1YUM 2.5 NADD_PSEAE
61 PsiBlast_CBE 58.6131% -61 - C1 -1YUM 2.5 NADD_PSEAE
58 PsiBlast_CBE 58.5531% -66 - C1 -1YUN 1.7 NADD_PSEAE
88 HHSearch 58.4734% -60 - C1 -1YUM 1.7 NADD_PSEAE