@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1385: (2016-05-01 )
MTGFGLRLAEAKARRGPLCLGIDPHPELLRGWDLATTADGLAAFCDICVRAFADFAVVKPQVAFFESYGAAGFAVLERTIAELRAADVLVLADAKRGDIGATMSAYATAWVGDSPLAADAVTASPYLGFGSLRPLLEVAAAHGRGVFVLAATSNPEGAAVQNAAADGRSVAQLVVDQVGAANEAAGPGPGSIGVVVGATAPQAPDLSAFTGPVLVPGVGVQGGRPEALGGLGGAASSQLLPAVAREVLRAGPGVPELRAAGERMRDAVAYLAAV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NUP_A_7(3N3M)
?
[Raw transfer]




U5P_A_2(2FFC)
?
[Raw transfer]




U5P_C_6(3QW4)
?
[Raw transfer]




U5P_C_6(3QW4)
?
[Raw transfer]




U5P_B_3(3QW4)
?
[Raw transfer]




NUP_B_12(3N3M)
?
[Raw transfer]




EDO_B_9(3N3M)
?
[Raw transfer]




110 HHSearch 81.0036%-109 - C4 -3QW4 3.0 ?
104 HHSearch 80.9823% -96 - C4 -2FFC 4.7 ?
106 HHSearch 80.4332%-102 - C4 -4MJZ - ? -
105 HHSearch 79.2820%-101 - C4 -2FDS - ? -
103 HHSearch 75.8322% -93 - C4 -3N3M 5.1 ?
109 HHSearch 75.1836%-107 - C4 -3QW3 - ? -
4 PsiBlast_PDB 74.9632%-102 - C4 -4MJZ - ? -
22 PsiBlast_CBE 74.4632%-102 - C4 -4MJZ - ? -
111 HHSearch 68.5522%-106 - C4 -3EWW - UMPS_HUMAN -
21 PsiBlast_CBE 66.4537% -86 - C4 -3QW4 4.4 ?
107 HHSearch 65.8323% -95 - C4 -3G3D - UMPS_HUMAN -
5 PsiBlast_PDB 64.8627% -76 - C4 -2FFC - ? -
2 PsiBlast_PDB 64.8537% -84 - C4 -3QW4 3.0 ?
6 PsiBlast_PDB 63.8726% -72 - C4 -2GUU - ? -
108 HHSearch 61.0220%-101 - C4 -3GDM - PYRF_YEAST -
122 Fugue 60.9319% -78 - C4 -2AQW - ? -
1 PsiBlast_PDB 59.6952% -44 - C4 -3V75 - ? -
102 HHSearch 58.1951% -44 - C4 -3V75 - ? -
11 PsiBlast_PDB 55.9527% -93 - C4 -2ZCG - ? -
13 PsiBlast_PDB 55.5827% -90 - C4 -2Q8Z - ? -