@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA2664: (2016-02-09 )
MLSNAQRALIKATVPLLETGGEALITHFYRTMLGEYPEVRPLFNQAHQASGDQPRALANGVLMYARHIDQLQELGPLVAKVVNKHVSLQVLPEHYPIVGTCLLRAIREVLGEQIATDEVLEAWGAAYQQLADLLIEAEESVYAASAQADGGWRGVRRFRVARKQAESEEITSFYLEPVDGQPLLAFQPGQYIGLRLDIDGEEVRRNYSLSAASNGREYRISVKREAGGRVSNYLHDRVAEGDELDLFPPAGDFVLRDSDKPLVLITAGVGITPALAMLQEALPQARPIRFIHCARHGGVHAFRDWIEDVSAQHEQVEHFFCYSEPRAGDSADAEGLLSREKLADWLPQERDLDAYFLGPRPFMAQVKRHLADLGVPSQQCHYEFFGPAAALDA

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_B_6(2VHB)
BAHG_VITST
[Raw transfer]




HEM_A_3(1VHB)
BAHG_VITST
[Raw transfer]




HEM_A_3(3VHB)
BAHG_VITST
[Raw transfer]




HEM_B_4(1VHB)
BAHG_VITST
[Raw transfer]




HEM_A_5(4VHB)
BAHG_VITST
[Raw transfer]




HEM_A_2(3OZU)
HMP_CUPNH
[Raw transfer]




HEM_A_5(2VHB)
BAHG_VITST
[Raw transfer]




HEM_A_2(2WY4)
?
[Raw transfer]




HEM_B_5(3VHB)
BAHG_VITST
[Raw transfer]




HEM_B_6(4VHB)
BAHG_VITST
[Raw transfer]




HEM_B_5(3TLD)
BAHG_VITST
[Raw transfer]




DGG_B_9(1CQX)
HMP_CUPNH
[Raw transfer]




FAD_B_8(1CQX)
HMP_CUPNH
[Raw transfer]




FAD_A_5(1CQX)
HMP_CUPNH
[Raw transfer]




FAD_A_2(1GVH)
HMP_ECOLI
[Raw transfer]




FAD_A_2(1GVH)
HMP_ECOLI
[Raw transfer]




FAD_A_2(1GVH)
HMP_ECOLI
[Raw transfer]




FAD_B_4(3OZV)
HMP_CUPNH
[Raw transfer]




FAD_A_5(1CQX)
HMP_CUPNH
[Raw transfer]




FAD_A_3(4G1V)
?
[Raw transfer]




FAD_A_8(3OZV)
HMP_CUPNH
[Raw transfer]




FAD_B_8(3OZW)
HMP_CUPNH
[Raw transfer]




FAD_A_4(3OZW)
HMP_CUPNH
[Raw transfer]




DGG_B_5(3OZV)
HMP_CUPNH
[Raw transfer]




GOL_B_11(2EIX)
?
[Raw transfer]




FAD_B_12(4EH1)
HMP_VIBCH
[Raw transfer]




FAD_A_3(4EH1)
HMP_VIBCH
[Raw transfer]




FAD_A_5(1CQX)
HMP_CUPNH
[Raw transfer]




FMN_A_2(2PIA)
?
[Raw transfer]




FAD_A_5(1CQX)
HMP_CUPNH
[Raw transfer]




21 PsiBlast_CBE 86.2343%-113 - C1 -3OZW 12.5 HMP_CUPNH
22 PsiBlast_CBE 85.5243%-111 - C1 -3OZV 12.6 HMP_CUPNH
58 HHSearch 85.4342%-104 - C1 -1GVH 10.4 HMP_ECOLI
1 PsiBlast_PDB 85.0743%-115 - C1 -3OZU 10.6 HMP_CUPNH
3 PsiBlast_PDB 84.9243%-112 - C1 -3OZW 11.6 HMP_CUPNH
5 PsiBlast_PDB 84.9141%-111 - C1 -1GVH 8.7 HMP_ECOLI
47 Fugue 84.8442%-107 - C1 -1GVH 10.4 HMP_ECOLI
25 PsiBlast_CBE 84.6137%-120 - C1 -4G1B - ? -
24 PsiBlast_CBE 84.5337%-118 - C1 -4G1B - ? -
26 PsiBlast_CBE 84.3137%-122 - C1 -4G1B - ? -
7 PsiBlast_PDB 84.3137%-118 - C1 -4G1V 11.9 ?
57 HHSearch 84.2043%-112 - C1 -1CQX 10.7 HMP_CUPNH
2 PsiBlast_PDB 83.9243%-111 * C1 *3OZV 12.7 HMP_CUPNH
4 PsiBlast_PDB 83.8343%-112 - C1 -1CQX 10.5 HMP_CUPNH
6 PsiBlast_PDB 83.8137%-120 - C1 -4G1B - ? -
23 PsiBlast_CBE 82.6943%-113 - C1 -1CQX 10.6 HMP_CUPNH
8 PsiBlast_PDB 57.2041% -99 - C1 -4EH1 10.1 HMP_VIBCH
10 PsiBlast_PDB 56.3345%-143 - C1 -2VHB 8.6 BAHG_VITST
28 PsiBlast_CBE 55.5345%-143 - C1 -4VHB 9.8 BAHG_VITST
27 PsiBlast_CBE 55.2341% -94 - C1 -4EH1 10.9 HMP_VIBCH
32 PsiBlast_CBE 55.1644%-140 - C1 -3TLD 11.5 BAHG_VITST
12 PsiBlast_PDB 54.8945%-143 - C1 -4VHB 9.6 BAHG_VITST
31 PsiBlast_CBE 54.3845%-141 - C1 -1VHB 11.6 BAHG_VITST
30 PsiBlast_CBE 54.0845%-151 - C1 -2VHB 8.4 BAHG_VITST
9 PsiBlast_PDB 53.5445%-139 - C1 -1VHB 11.6 BAHG_VITST
11 PsiBlast_PDB 53.1645%-143 - C1 -3VHB 10.3 BAHG_VITST
29 PsiBlast_CBE 52.4345%-139 - C1 -3VHB 10.2 BAHG_VITST
13 PsiBlast_PDB 49.1544%-118 - C1 -2WY4 11.5 ?
50 Fugue 45.2535%-132 - C1 -1CQX 3.3 HMP_CUPNH
48 Fugue 40.5852% -71 - C1 -1CQX 9.1 HMP_CUPNH