@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0491: (2016-03-16 )
MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVVEWRVDFFEDVKDLAKVEAALGEIRAILPETPILFTFRSAKEGGELAVSDEFYFELNETLAGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSAGDVLTLLDATNTVFEKANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF

Atome Classification :

(45 SA) .........10........20........30........40-----........50........60........70........80........90........100.......110.......120..-----.....130.......140.......150.......160.......170.......180.......190.-.-.....200.......210.......220.......230.......240.......250
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTID-----LDVVEWRVDFFEDVKDLAKVEAALGEIRAILPETPILFTFRSAKEGGELAVSDEFYFELNETLAGTGKIDLVDVELFNEEADV-----LRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSAGDVLTLLDATNTVFE-K-ANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF
21 PsiBlast_CBE 98.1158%-104 - C6 -4H3D AROD_PEPD6 D:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDAC-----LDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI-----DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIY-ADRPIITMSMSGMGVISRLCGEIFGSALTFGAAK--SAPGQISFKELNSVLNLLHKS-
23 PsiBlast_CBE 97.5358%-103 - C6 -4H3D AROD_PEPD6 B:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDAC-----LDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI-----DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIY-ADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHKS-
1 PsiBlast_PDB 97.4458%-101 - C6 -3JS3 AROD_PEPD6 A:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDAC-----LDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI-----DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIY-ADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHKS-
2 PsiBlast_PDB 97.4158%-102 - C6 -4H3D AROD_PEPD6 A:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDAC-----LDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI-----DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIY-ADRPIITMSMSGMGVISRLCGEIFGSALTFGAAK---APGQISFKELNSVLNLLHKS-
25 PsiBlast_CBE 97.2458%-102 - C6 -3JS3 AROD_PEPD6 C:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDAC-----LDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI-----DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIY-ADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHKS-
24 PsiBlast_CBE 97.1958%-100 - C6 -3JS3 AROD_PEPD6 D:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDAC-----LDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI-----DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIY-ADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHKS-
22 PsiBlast_CBE 97.1558%-102 - C6 -4H3D AROD_PEPD6 C:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDAC-----LDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI-----DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIY-ADRPIITMSMSGMGVISRLCGEIFGSALTFGAAK---APGQISFKELNSVLNLLHKS-
29 PsiBlast_CBE 95.8256%-101 - C6 -4GFS AROD_SALTY B:[4-254] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK---APGQISVADLRTVLTILHQ--
43 PsiBlast_CBE 95.7855% -97 - C6 -1QFE AROD_SALTI B:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
26 PsiBlast_CBE 95.6558% -98 - C6 -3JS3 AROD_PEPD6 B:[7-256] --KVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDAC-----LDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI-----DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIY-ADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHKS-
45 PsiBlast_CBE 95.5455% -92 - C6 -1L9W AROD_SALTI C:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
37 PsiBlast_CBE 95.4756% -96 - C6 -3M7W AROD_SALTY B:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
85 Fugue 95.4654% -97 * C6 *1QFE AROD_SALTI A:[1-252] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA-
14 PsiBlast_PDB 95.2755% -97 - C6 -1QFE AROD_SALTI A:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
44 PsiBlast_CBE 95.1655% -93 - C6 -1L9W AROD_SALTI D:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
32 PsiBlast_CBE 95.1456% -98 - C6 -3OEX AROD_SALTY B:[4-254] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
15 PsiBlast_PDB 95.1255% -95 - C6 -1L9W AROD_SALTI A:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
17 PsiBlast_PDB 95.0455% -96 - C6 -3NNT AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
31 PsiBlast_CBE 95.0056% -97 - C6 -3OEX AROD_SALTY C:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
35 PsiBlast_CBE 94.8956% -97 - C6 -3M7W AROD_SALTY D:[4-254] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
6 PsiBlast_PDB 94.7056% -98 - C6 -4GUI AROD_SALTY A:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
51 PsiBlast_CBE 94.6854% -98 - C6 -4CNP AROD_SALTI B:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
46 PsiBlast_CBE 94.6355% -97 - C6 -1L9W AROD_SALTI B:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
52 PsiBlast_CBE 94.4854% -96 - C6 -4CNP AROD_SALTI A:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
7 PsiBlast_PDB 94.4356% -96 - C6 -4GUJ AROD_SALTY A:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
50 PsiBlast_CBE 94.2954% -97 - C6 -4UIO ? A:[3-250] --TVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
20 PsiBlast_PDB 94.2854% -98 - C6 -4CNO AROD_SALTI A:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH---
58 PsiBlast_CBE 94.1454% -97 - C6 -4CLM AROD_SALTI B:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH---
27 PsiBlast_CBE 94.0856% -98 - C6 -4GUJ AROD_SALTY B:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
55 PsiBlast_CBE 93.6754% -99 - C6 -4CNO AROD_SALTI B:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH---
9 PsiBlast_PDB 93.6556% -95 - C6 -3LB0 AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
56 PsiBlast_CBE 93.6454%-100 - C6 -4CNN AROD_SALTI B:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH---
54 PsiBlast_CBE 93.6454% -98 - C6 -4CNO AROD_SALTI C:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH---
28 PsiBlast_CBE 93.6356% -94 - C6 -4GUI AROD_SALTY B:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
48 PsiBlast_CBE 93.6255% -98 - C6 -3NNT AROD_SALTY B:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
38 PsiBlast_CBE 93.4756% -96 - C6 -3S42 AROD_SALTY B:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
13 PsiBlast_PDB 93.3655% -97 - C6 -4GUH AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
53 PsiBlast_CBE 93.2254% -94 - C6 -4CNO AROD_SALTI D:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREAT-----FDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV-----KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQ-HYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH---
40 PsiBlast_CBE 92.7355% -93 - C6 -4GUH AROD_SALTY B:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
47 PsiBlast_CBE 92.5255% -95 - C6 -4IUO AROD_SALTY B:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--
12 PsiBlast_PDB 92.4955%-101 - C6 -4GUG AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK----PGQISVADLRTVLTILHQ--
18 PsiBlast_PDB 92.4555% -94 - C6 -4IUO AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREAD-----FDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV-----KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQE-RYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--