@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00150: (2016-06-01 )
MNTAPFIAIEGPIGAGKTTLATMLSQKFGFPMINEIVEDNPYLDKFYDNIKEWSFQLEMFFLCHRYKQLEDTSDHFLKKGQPVIADYHIYKNVIFAERTLSPHQLEKYKKIYHLLTDDLPKPNFIIYIKASLPTLLHRIEKRGRPFEKKIETSYLEQLISDYEVAIKQLQEADPELTVLTVDGDSKDFVLNKSDFERIAAHVKELIV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_4(1P5Z)
DCK_HUMAN
[Raw transfer]




74 HHSearch 91.6030%-105 - C2 -2JAQ - ? -
18 PsiBlast_PDB 89.0723%-107 - C2 -4JLK - DCK_HUMAN -
72 HHSearch 88.9026% -98 * C2 *2OCP - DGUOK_HUMAN -
8 PsiBlast_PDB 88.7723% -99 - C2 -2NOA - DCK_HUMAN -
9 PsiBlast_PDB 88.7123%-100 - C2 -2NO0 - DCK_HUMAN -
7 PsiBlast_PDB 87.8223%-101 - C2 -2NO9 - DCK_HUMAN -
14 PsiBlast_PDB 87.6023%-106 - C2 -2ZI5 - DCK_HUMAN -
12 PsiBlast_PDB 87.3323% -98 - C2 -2NO7 - DCK_HUMAN -
10 PsiBlast_PDB 87.2523%-104 - C2 -2NO1 - DCK_HUMAN -
11 PsiBlast_PDB 87.2423% -99 - C2 -2NO6 - DCK_HUMAN -
19 PsiBlast_PDB 87.1823%-104 - C2 -4L5B - DCK_HUMAN -
73 HHSearch 86.6926% -97 - C2 -1P5Z 8.2 DCK_HUMAN
17 PsiBlast_PDB 86.6023%-105 - C2 -3QEN - DCK_HUMAN -
4 PsiBlast_PDB 85.8625% -98 - C2 -2A2Z - DCK_HUMAN -
5 PsiBlast_PDB 84.3525%-101 - C2 -2A30 - DCK_HUMAN -
20 PsiBlast_PDB 83.5723%-103 - C2 -4JLJ - DCK_HUMAN -
13 PsiBlast_PDB 83.1423% -99 - C2 -2ZI4 - DCK_HUMAN -
2 PsiBlast_PDB 82.4231%-108 - C1 -2JAQ - ? -
16 PsiBlast_PDB 81.5523%-103 - C2 -3KFX - DCK_HUMAN -
15 PsiBlast_PDB 81.1023% -94 - C2 -3MJR - DCK_HUMAN -