@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1760: (2016-03-28 )
MKHLFKLDPAKNLPTNDVTKLIHSGTDGFIIGGTDNVQIEAVQNLYELLVETDLPIFLEISNESMILPEADHFLIPVVLNTENSKWTHGLHKELIKEMGEFIPWKRVTSEGYVILNKDAKVAHLTEAKTDLTDEDIVAYARLAENIFHLPIFYVEYSGMYGDPEVVRKASAALSNTKFWYGGGIRSKEQAAEMAKYADTIIVGNIIYEDLEKALETATIFRKKTV

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

1GP_B_13(3VZY)
PCRB_BACSU
[Raw transfer]




CIT_B_4(2F6U)
GGGPS_ARCFU
[Raw transfer]




CIT_A_3(2F6U)
GGGPS_ARCFU
[Raw transfer]




CIT_A_3(2F6U)
GGGPS_ARCFU
[Raw transfer]




1GP_A_3(2F6X)
GGGPS_ARCFU
[Raw transfer]




1GP_B_5(3W00)
PCRB_BACSU
[Raw transfer]




1GP_B_4(2F6X)
GGGPS_ARCFU
[Raw transfer]




FPS_B_5(3VZZ)
PCRB_BACSU
[Raw transfer]




FPS_B_4(3W00)
PCRB_BACSU
[Raw transfer]




27 PsiBlast_CBE 97.2545%-121 - C3 -3W01 - PCRB_STAA1 -
7 PsiBlast_PDB 97.1845%-116 - C3 -3W01 - PCRB_STAA1 -
1 PsiBlast_PDB 97.1646%-120 - C3 -4NAF - ? -
34 HHSearch 96.6344%-116 - C3 -3W01 - PCRB_STAA1 -
26 PsiBlast_CBE 96.5945%-111 - C3 -3W02 - PCRB_STAA1 -
8 PsiBlast_PDB 95.8945%-113 - C3 -3W02 - PCRB_STAA1 -
6 PsiBlast_PDB 95.4145%-119 - C3 -3W00 - PCRB_BACSU -
3 PsiBlast_PDB 95.4045%-118 - C3 -3VZX - PCRB_BACSU -
33 HHSearch 95.2344%-120 - C3 -3VZX - PCRB_BACSU -
53 Fugue 95.0644%-106 - C3 -1VIZ - PCRB_BACSU -
23 PsiBlast_CBE 94.9145%-112 - C3 -3VZZ 5.6 PCRB_BACSU
4 PsiBlast_PDB 94.8745%-116 - C3 -3VZY - PCRB_BACSU -
5 PsiBlast_PDB 94.7845%-116 - C3 -3VZZ - PCRB_BACSU -
2 PsiBlast_PDB 94.5845%-118 - C3 -1VIZ - PCRB_BACSU -
22 PsiBlast_CBE 94.4445%-111 - C3 -3W00 5.4 PCRB_BACSU
24 PsiBlast_CBE 93.9345%-111 - C3 -3VZY 3.9 PCRB_BACSU
25 PsiBlast_CBE 93.5545%-114 - C3 -3VZX - PCRB_BACSU -
21 PsiBlast_CBE 91.4645%-117 - C3 -1VIZ - PCRB_BACSU -
29 PsiBlast_CBE 88.3739%-104 - C3 -2F6U 3.8 GGGPS_ARCFU
32 HHSearch 88.2040%-108 - C3 -2F6U 4.6 GGGPS_ARCFU
10 PsiBlast_PDB 88.0739%-103 - C3 -2F6X 4.2 GGGPS_ARCFU
9 PsiBlast_PDB 87.3239%-104 - C3 -2F6U 4.7 GGGPS_ARCFU
28 PsiBlast_CBE 87.0439%-104 - C3 -2F6X 2.9 GGGPS_ARCFU