@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2089: (2016-03-31 )
VKNTIKWIAIGFAGIILLPLLIVFFIYKKAVGKKDYNPEVLENLDKASQEFVKNTSPLSDVDSRYKYMRLATKALPSAKDIEIGDVENKKIDGPAGKIPIRIYTPQEDGPFEIIVYYHGGGFVLGGLQTHDAIARKLVQTTGARVVTVDYRLAPENPFPAAVEDAYAALLWVQNHRTSLRAKSSDIIVAGDSVGGNLATVVTQIAKSKGKPNITAQILLYPATDIFSRDASVLYPSMDEFAEGYVLTKESLDKFFKLYIANASDRKYDPLVAPIRSKDLVGLPKTFIATAEFDPLRDQGEAYAKKLKDAGVEVFAKRFEKVPHGFMTTNSEATDETYELISEFLEEK

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BOG_A_2(3WJ1)
?
[Raw transfer]




DEP_B_8(3AIL)
?
[Raw transfer]




BOG_A_2(3WJ1)
?
[Raw transfer]




DEP_A_5(3AIL)
?
[Raw transfer]




EPE_A_2(1EVQ)
?
[Raw transfer]




DEP_C_11(3AIL)
?
[Raw transfer]




DEP_D_15(3AIL)
?
[Raw transfer]




MPD_A_5(3AIN)
?
[Raw transfer]




MRD_C_13(3AIM)
?
[Raw transfer]




MPD_A_5(3AIK)
?
[Raw transfer]




MRD_C_13(3AIK)
?
[Raw transfer]




MPD_A_5(3AIM)
?
[Raw transfer]




MPD_B_9(3AIK)
?
[Raw transfer]




MRD_C_16(3AIO)
?
[Raw transfer]




MRD_D_17(3AIK)
?
[Raw transfer]




MPD_A_5(3AIO)
?
[Raw transfer]




MRD_C_15(3AIN)
?
[Raw transfer]




MRD_D_18(3AIN)
?
[Raw transfer]




BME_C_16(3DNM)
?
[Raw transfer]




MRD_B_9(3AIO)
?
[Raw transfer]




BME_D_19(3DNM)
?
[Raw transfer]




MRD_D_21(3AIO)
?
[Raw transfer]




MRD_D_17(3AIM)
?
[Raw transfer]




BME_D_14(3K6K)
?
[Raw transfer]




BME_A_5(3DNM)
?
[Raw transfer]




MPD_A_2(4OB8)
?
[Raw transfer]




BME_B_8(3DNM)
?
[Raw transfer]




MPD_A_2(4OB7)
?
[Raw transfer]




MPD_B_12(3AIN)
?
[Raw transfer]




MRD_B_10(3AIM)
?
[Raw transfer]




81 HHSearch 88.3943%-101 * C1 *3WJ1 Error ?
83 HHSearch 88.2640% -99 - C1 -1JJI - ? -
1 PsiBlast_PDB 86.6543% -92 - C1 -3WJ1 Error ?
8 PsiBlast_PDB 84.7642% -92 - C1 -4P9N - ? -
69 Fugue 79.9234% -74 - C1 -1JJI - ? -
2 PsiBlast_PDB 79.7938% -72 - C1 -1QZ3 - ? -
82 HHSearch 79.5533% -95 - C1 -1LZL - ? -
85 HHSearch 79.4241% -94 - C1 -2HM7 - ? -
4 PsiBlast_PDB 78.8442% -96 - C1 -1JJI - ? -
12 PsiBlast_PDB 78.1042% -90 - C1 -3AIN 2.8 ?
9 PsiBlast_PDB 78.0438% -77 - C1 -1EVQ 1.7 ?
29 PsiBlast_CBE 77.5042% -87 - C1 -3AIK 3.2 ?
32 PsiBlast_CBE 77.2542% -88 - C1 -3AIO 3.1 ?
21 PsiBlast_CBE 77.2342% -96 - C1 -1JJI - ? -
33 PsiBlast_CBE 77.1542% -89 - C1 -3AIM 1.8 ?
10 PsiBlast_PDB 77.1242% -91 - C1 -3AIO 2.8 ?
6 PsiBlast_PDB 77.0442% -90 - C1 -3AIK 2.9 ?
24 PsiBlast_CBE 76.9742% -89 - C1 -3AIL 3.2 ?
25 PsiBlast_CBE 76.9042% -91 - C1 -3AIL 3.2 ?
38 PsiBlast_CBE 76.8842% -88 - C1 -3AIN 2.5 ?
27 PsiBlast_CBE 76.7942% -91 - C1 -3AIK 2.6 ?
11 PsiBlast_PDB 76.7142% -90 - C1 -3AIM 2.2 ?
37 PsiBlast_CBE 76.4742% -88 - C1 -3AIN 2.5 ?
36 PsiBlast_CBE 76.2342% -87 - C1 -3AIN 2.6 ?
26 PsiBlast_CBE 76.1642% -90 - C1 -3AIL 3.3 ?
35 PsiBlast_CBE 75.4642% -90 - C1 -3AIM 2.6 ?
28 PsiBlast_CBE 75.4342% -88 - C1 -3AIK 3.2 ?
34 PsiBlast_CBE 75.3342% -89 - C1 -3AIM 2.2 ?
7 PsiBlast_PDB 75.3042% -88 - C1 -3AIL 3.1 ?
30 PsiBlast_CBE 75.2942% -90 - C1 -3AIO 2.6 ?
31 PsiBlast_CBE 75.2342% -89 - C1 -3AIO 3.2 ?
16 PsiBlast_PDB 74.0936% -70 - C1 -4OB8 3.0 ?
17 PsiBlast_PDB 73.5636% -71 - C1 -4OB7 2.9 ?
45 PsiBlast_CBE 54.6737% -86 - C1 -3DNM 2.0 ?
41 PsiBlast_CBE 52.8737% -82 - C1 -3K6K 2.8 ?
48 PsiBlast_CBE 50.4837% -81 - C1 -3DNM 2.8 ?
46 PsiBlast_CBE 49.3137% -75 - C1 -3DNM 2.5 ?
47 PsiBlast_CBE 45.5137% -73 - C1 -3DNM 2.8 ?