@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2211: (2016-04-01 )
MTKKVGLLVMAYGTPYKDEDIERYYTDIRHGHKPSEEMIADLRGRYHAIGGLSPLAKITEAQAYGLEKALNDSQDEVEFKAYIGLKHIEPFIEDAVEAMHKDGIEEAISIVLAPHYSSFSVEAYNKRAKEAADKLGGPRINAINDWYKQPKFIQMWADRINETAKQIPADELLDTVLIVSAHSLPEKIKQHNDPYPNQLQETADFIFEKVVVPHYALGWQSEGKTGEPWLGPDVQDLTRELYGREKYKHFIYTPVGFVAEHLEVLYDNDYECKVVTDEVGAAYHRPPMPNSDPEFLEVLRTVVWEKYSN

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MP1_A_3(1C9E)
HEMH_BACSU
[Raw transfer]




H01_A_3(2Q2O)
HEMH_BACSU
[Raw transfer]




MMP_A_3(1C1H)
HEMH_BACSU
[Raw transfer]




HEM_A_3(4KMM)
HEMH_HUMAN
[Raw transfer]




HEM_B_16(3HCO)
HEMH_HUMAN
[Raw transfer]




HEM_B_5(2QD3)
HEMH_HUMAN
[Raw transfer]




H01_A_4(2Q2N)
HEMH_BACSU
[Raw transfer]




H02_A_3(2Q3J)
HEMH_BACSU
[Raw transfer]




HEM_A_9(3HCO)
HEMH_HUMAN
[Raw transfer]




HEM_B_15(2QD2)
HEMH_HUMAN
[Raw transfer]




PP9_B_12(2QD5)
HEMH_HUMAN
[Raw transfer]




HEM_B_16(3HCN)
HEMH_HUMAN
[Raw transfer]




HEM_B_8(4KMM)
HEMH_HUMAN
[Raw transfer]




PP9_A_11(2QD5)
HEMH_HUMAN
[Raw transfer]




IMD_A_6(2HRC)
HEMH_HUMAN
[Raw transfer]




CHD_A_11(2QD4)
HEMH_HUMAN
[Raw transfer]




CHD_B_16(2QD4)
HEMH_HUMAN
[Raw transfer]




CHD_B_9(4MK4)
HEMH_HUMAN
[Raw transfer]




CHD_A_5(4MK4)
HEMH_HUMAN
[Raw transfer]




IMD_A_7(2QD2)
HEMH_HUMAN
[Raw transfer]




CHD_A_6(2QD3)
HEMH_HUMAN
[Raw transfer]




IMD_A_6(3HCN)
HEMH_HUMAN
[Raw transfer]




ACY_B_16(2QD5)
HEMH_HUMAN
[Raw transfer]




ACY_A_17(2QD5)
HEMH_HUMAN
[Raw transfer]




CHD_A_7(2QD3)
HEMH_HUMAN
[Raw transfer]




5 PsiBlast_PDB 99.1167% -96 - C9 -1AK1 - HEMH_BACSU -
3 PsiBlast_PDB 99.0367% -95 - C9 -1N0I - HEMH_BACSU -
14 PsiBlast_PDB 98.9266% -97 - C9 -2Q2O 6.9 HEMH_BACSU
12 PsiBlast_PDB 98.7866% -95 - C9 -3GOQ - HEMH_BACSU -
13 PsiBlast_PDB 98.6266% -96 - C9 -2AC4 - HEMH_BACSU -
7 PsiBlast_PDB 98.5367% -94 - C9 -2Q2N 4.7 HEMH_BACSU
8 PsiBlast_PDB 98.3367% -96 - C9 -3M4Z - HEMH_BACSU -
2 PsiBlast_PDB 98.2867% -96 - C9 -1LD3 - HEMH_BACSU -
44 HHSearch 98.2666% -91 - C9 -2H1V - HEMH_BACSU -
6 PsiBlast_PDB 98.2467% -94 - C9 -1DOZ - HEMH_BACSU -
9 PsiBlast_PDB 98.1266% -95 - C9 -2AC2 - HEMH_BACSU -
11 PsiBlast_PDB 98.1166% -93 - C9 -2H1V - HEMH_BACSU -
1 PsiBlast_PDB 97.9567% -95 - C9 -1C1H 10.3 HEMH_BACSU
10 PsiBlast_PDB 97.8266% -97 - C9 -1C9E 10.3 HEMH_BACSU
15 PsiBlast_PDB 97.7866% -95 - C9 -2Q3J 6.2 HEMH_BACSU
4 PsiBlast_PDB 97.7567% -94 - C9 -2HK6 - HEMH_BACSU -
16 PsiBlast_PDB 96.9566% -92 - C9 -2H1W - HEMH_BACSU -
62 Fugue 96.3265% -92 - C9 -1DOZ - HEMH_BACSU -
17 PsiBlast_PDB 96.2063% -96 - C9 -2C8J - HEMH1_BACAN -
43 HHSearch 78.1028% -75 - C9 -3HCN - HEMH_HUMAN -
19 PsiBlast_PDB 72.7830% -74 - C9 -2HRC 2.8 HEMH_HUMAN
20 PsiBlast_PDB 71.8931% -71 - C9 -4MK4 3.2 HEMH_HUMAN
22 PsiBlast_CBE 71.6431% -68 - C9 -4KMM 6.6 HEMH_HUMAN
35 PsiBlast_CBE 71.3831% -75 - C9 -2QD3 3.8 HEMH_HUMAN
28 PsiBlast_CBE 71.3231% -74 - C9 -3HCN 6.9 HEMH_HUMAN
33 PsiBlast_CBE 71.0831% -73 - C9 -2QD4 3.4 HEMH_HUMAN
29 PsiBlast_CBE 71.0431% -76 - C9 -3HCN 2.7 HEMH_HUMAN
38 PsiBlast_CBE 70.9231% -75 - C9 -2QD2 7.4 HEMH_HUMAN
39 PsiBlast_CBE 70.8231% -76 - C9 -2QD2 3.5 HEMH_HUMAN
21 PsiBlast_CBE 70.8231% -67 - C9 -4MK4 3.8 HEMH_HUMAN
27 PsiBlast_CBE 70.7531% -75 - C9 -3HCO 7.3 HEMH_HUMAN
32 PsiBlast_CBE 70.6131% -73 - C9 -2QD4 2.8 HEMH_HUMAN
23 PsiBlast_CBE 70.6031% -70 - C9 -4KMM 5.5 HEMH_HUMAN
26 PsiBlast_CBE 70.3331% -74 - C9 -3HCO 7.5 HEMH_HUMAN
34 PsiBlast_CBE 70.3231% -70 - C9 -2QD3 6.4 HEMH_HUMAN
30 PsiBlast_CBE 69.9631% -75 - C9 -2QD5 6.0 HEMH_HUMAN
31 PsiBlast_CBE 69.5331% -74 - C9 -2QD5 5.2 HEMH_HUMAN