@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2663: (2016-04-06 )
LKAVVKTNPGYDQMELKDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLGHEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKEHDYNLCSNRRGIGTQANGSFAEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLLAQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTGGYGAERVFDCSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILALDLLANGKIDTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_A_5(3QE3)
DHSO_SHEEP
[Raw transfer]
8 PsiBlast_PDB 90.4233% -89 - C1 -1E3J - ? -
2 PsiBlast_PDB 89.9535% -83 - C1 -4EJM - ? -
1 PsiBlast_PDB 88.0235% -83 - C1 -4EJ6 - ? -
51 HHSearch 87.4336% -85 - C1 -2D8A - TDH_PYRHO -
5 PsiBlast_PDB 82.6534% -82 - C1 -2DFV - TDH_PYRHO -
23 PsiBlast_CBE 81.8234% -86 - C1 -3GFB - TDH_THEKO -
22 PsiBlast_CBE 80.7234% -83 - C1 -3GFB - TDH_THEKO -
3 PsiBlast_PDB 80.4034% -82 - C1 -3GFB - TDH_THEKO -
4 PsiBlast_PDB 79.7234% -82 - C1 -2D8A - TDH_PYRHO -
21 PsiBlast_CBE 79.4134% -83 - C1 -3GFB - TDH_THEKO -
7 PsiBlast_PDB 77.0931% -75 - C1 -2EJV - TDH_THET8 -
24 PsiBlast_CBE 76.1731% -72 - C1 -2EJV - TDH_THET8 -
6 PsiBlast_PDB 74.9431% -72 - C1 -2DQ4 - TDH_THET8 -
50 HHSearch 74.0832% -74 * C1 *2DQ4 - TDH_THET8 -
25 PsiBlast_CBE 73.4431% -72 - C1 -2DQ4 - TDH_THET8 -
48 HHSearch 73.3727% -76 - C1 -2EIH - ? -
52 HHSearch 71.4125% -83 - C1 -1E3I - ADH4_MOUSE -
16 PsiBlast_PDB 71.2929% -76 - C1 -3QE3 3.1 DHSO_SHEEP
59 HHSearch 70.6427% -78 - C1 -2FZW - ADHX_HUMAN -
10 PsiBlast_PDB 70.5431% -88 - C1 -3PII - ADH3_GEOSE -