@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0851c: (2016-04-26 )
MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRLLGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAKYGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSSTTGSPGPLPLQDDNLGVDDIAQLTADAILANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UNL_A_3(3TJR)
?
[Raw transfer]




3HR_A_3(3W8E)
?
[Raw transfer]




DXX_A_3(3W8D)
?
[Raw transfer]




3HL_A_6(2ZTL)
?
[Raw transfer]




GOL_D_13(4FN4)
?
[Raw transfer]




3HL_C_12(2ZTL)
?
[Raw transfer]




3HR_C_19(3VDR)
?
[Raw transfer]




3HL_A_6(2ZTM)
?
[Raw transfer]




3HR_B_15(3VDR)
?
[Raw transfer]




3HL_B_9(2ZTL)
?
[Raw transfer]




3HL_D_14(2ZTL)
?
[Raw transfer]




MLA_A_3(3W8F)
?
[Raw transfer]




3HR_D_24(3VDR)
?
[Raw transfer]




3HR_A_9(3VDR)
?
[Raw transfer]




THJ_A_4(3GED)
?
[Raw transfer]




1 PsiBlast_PDB 99.2678%-121 - C1 -3TJR 12.9 ?
7 PsiBlast_PDB 66.0531%-117 - C1 -4Y9D - ? -
9 PsiBlast_PDB 65.5333%-116 - C1 -4YAC - ? -
6 PsiBlast_PDB 65.3931%-115 - C1 -4Y98 - ? -
8 PsiBlast_PDB 65.0333%-119 - C1 -4YA6 - ? -
5 PsiBlast_PDB 64.7033%-112 - C1 -3IOY - ? -
22 PsiBlast_CBE 62.6934% -97 - C1 -4YAG - ? -
2 PsiBlast_PDB 62.1334%-111 - C1 -4YAE - ? -
21 PsiBlast_CBE 61.4634% -97 - C1 -4YAI - ? -
4 PsiBlast_PDB 61.0334% -96 - C1 -4YAI - ? -
3 PsiBlast_PDB 61.0234% -95 - C1 -4YAG - ? -
122 HHSearch 56.8326%-100 - C1 -3TSC - ? -
50 PsiBlast_CBE 53.3935%-119 - C1 -3AWD - ? -
66 PsiBlast_CBE 52.8835%-119 - C1 -2ZTL 3.8 ?
128 HHSearch 52.7228% -96 - C1 -4FN4 - ? -
17 PsiBlast_PDB 51.9735%-120 - C1 -3W8D 3.4 ?
51 PsiBlast_CBE 51.7535%-115 - C1 -3AWD - ? -
34 PsiBlast_CBE 51.7235%-114 - C1 -3VDQ - ? -
43 PsiBlast_CBE 51.6935%-119 - C1 -2YZ7 - ? -
18 PsiBlast_PDB 51.6735%-119 - C1 -3W8E 3.4 ?
31 PsiBlast_CBE 51.5735%-119 - C1 -3VDR 2.5 ?
32 PsiBlast_CBE 50.9735%-118 - C1 -3VDR 2.5 ?
65 PsiBlast_CBE 50.3635%-120 - C1 -2ZTL 3.8 ?
63 PsiBlast_CBE 49.9135%-119 - C1 -2ZTL 2.8 ?
33 PsiBlast_CBE 49.7535%-118 - C1 -3VDR 3.2 ?
19 PsiBlast_PDB 49.3735%-118 - C1 -3W8F 3.5 ?
64 PsiBlast_CBE 49.2035%-119 - C1 -2ZTL 3.8 ?
15 PsiBlast_PDB 49.0035%-114 - C1 -3VDR 2.7 ?
83 PsiBlast_CBE 48.7535%-120 - C1 -2ZTM 3.6 ?
53 PsiBlast_CBE 47.2933%-115 - C1 -4FN4 3.1 ?