@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0006: (2015-12-17 )
MSRSLLILDRDGVINLDSDDYIKTLDEWIPIPSSIEAIARLSQAGWTVAVATNQSGIARGYYDLAVLEAMHARLRELVAEQGGEVGLIVYCPHGPDDGCDCRKPKPGMLRQIGEHYGVDLSGIWFVGDSIGDLEAARAVDCQPVLVKTGKGVRTLGKPLPEGTLIFDDLAAVASALLQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_A_9(3L8H)
GMHBB_BORBR
[Raw transfer]




35 HHSearch 92.9458%-130 * C3 *3L8H 3.0 GMHBB_BORBR
1 PsiBlast_PDB 91.0657%-131 - C3 -3L8H - GMHBB_BORBR -
55 Fugue 83.9635%-127 - C3 -2GMW - GMHBB_ECOLI -
36 HHSearch 82.9236%-128 - C3 -2GMW - GMHBB_ECOLI -
2 PsiBlast_PDB 75.2937%-125 - C3 -3L8E - GMHBB_ECOLI -
3 PsiBlast_PDB 74.6437%-124 - C3 -2GMW - GMHBB_ECOLI -
21 PsiBlast_CBE 74.5637%-126 - C3 -3L8E - GMHBB_ECOLI -
24 PsiBlast_CBE 74.1337%-120 - C3 -2GMW - GMHBB_ECOLI -
6 PsiBlast_PDB 74.1337%-122 - C3 -3L1U - GMHBB_ECOLI -
23 PsiBlast_CBE 74.0337%-127 - C3 -3L1U - GMHBB_ECOLI -
22 PsiBlast_CBE 73.9637%-123 - C3 -3L1V - GMHBB_ECOLI -
4 PsiBlast_PDB 73.7937%-123 - C3 -3ESQ - GMHBB_ECOLI -
7 PsiBlast_PDB 73.3537%-127 - C3 -3L1V - GMHBB_ECOLI -
9 PsiBlast_PDB 72.3536%-120 - C3 -3L8G - GMHBB_ECOLI -
5 PsiBlast_PDB 72.3437%-120 - C3 -3ESR - GMHBB_ECOLI -
8 PsiBlast_PDB 72.0336%-123 - C3 -3L8F - GMHBB_ECOLI -
10 PsiBlast_PDB 71.9035%-111 - C3 -2O2X - GMHBB_RHILO -
12 PsiBlast_PDB 61.9827%-126 - C3 -2FPS - HIS7_ECO57 -
11 PsiBlast_PDB 61.6227%-125 - C3 -2FPR - HIS7_ECO57 -
14 PsiBlast_PDB 61.3727%-125 - C3 -2FPX - HIS7_ECO57 -