@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4730: (2016-02-29 )
MNTVKTVRELRAAVARARSEGKRIGFVPTMGNLHAGHAALVKKAGERADFVVVSIFVNPLQFGPSEDLDTYPRTLAADQERLLEAGCHLLFTPTVEEMYPDGMDGQTRIHVPGVSEGLCGASRPGHFEGVATVVSKLLNMVQPDLALFGEKDFQQLAVIRKLVRDLNLPVQIFGEPTVRAADGLALSSRNGYLDEQQRAAAPAIYRTLRQLGERIRAGAEDFPALLADARQALEQAGLRPDYLEIREPISLRPGVPGDRQLVILAAAYLGSTRLIDNLSVHLD

Atome Classification :

(98 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PAJ_B_9(3AG6)
PANC_STAA8
[Raw transfer]




PAJ_A_3(3AG6)
PANC_STAA8
[Raw transfer]




ATP_C_9(3INN)
PANC_BRUME
[Raw transfer]




ATP_A_5(3INN)
PANC_BRUME
[Raw transfer]




ATP_D_13(3INN)
PANC_BRUME
[Raw transfer]




APC_B_5(2X3F)
PANC_STAAR
[Raw transfer]




52H_B_4(3COW)
PANC_MYCTU
[Raw transfer]




ATP_B_9(4G5Y)
PANC_MYCTU
[Raw transfer]




ATP_A_3(4G5Y)
PANC_MYCTU
[Raw transfer]




2DJ_A_5(4MUF)
PANC_MYCTO
[Raw transfer]




A7D_A_3(3IOE)
PANC_MYCTU
[Raw transfer]




53H_B_4(3COY)
PANC_MYCTU
[Raw transfer]




A7D_B_9(3IOE)
PANC_MYCTU
[Raw transfer]




2DQ_A_7(4MUI)
PANC_MYCTO
[Raw transfer]




FG6_B_14(3IVX)
PANC_MYCTU
[Raw transfer]




2DU_A_6(4MUJ)
PANC_MYCTO
[Raw transfer]




FG5_B_16(3IVG)
PANC_MYCTU
[Raw transfer]




AMP_B_9(3Q10)
PANC_YERPE
[Raw transfer]




0JD_B_8(4DE5)
PANC_MYCTU
[Raw transfer]




2DQ_B_10(4MUI)
PANC_MYCTO
[Raw transfer]




AMP_C_12(3Q10)
PANC_YERPE
[Raw transfer]




2DW_A_6(4MUL)
PANC_MYCTO
[Raw transfer]




A5D_A_5(3IOC)
PANC_MYCTU
[Raw transfer]




2DU_B_11(4MUJ)
PANC_MYCTO
[Raw transfer]




AMP_A_3(3UK2)
PANC_BURTA
[Raw transfer]




GOL_B_16(3MUE)
PANC_SALTY
[Raw transfer]




PAF_C_8(3Q12)
PANC_YERPE
[Raw transfer]




A6D_A_3(3IOD)
PANC_MYCTU
[Raw transfer]




A6D_B_9(3IOD)
PANC_MYCTU
[Raw transfer]




FG4_A_3(3IVC)
PANC_MYCTU
[Raw transfer]




2DV_A_3(4MUK)
PANC_MYCTO
[Raw transfer]




PAF_A_5(3Q12)
PANC_YERPE
[Raw transfer]




GOL_B_10(1V8F)
PANC_THET8
[Raw transfer]




0JD_A_3(4DE5)
PANC_MYCTU
[Raw transfer]




GOL_B_14(3COV)
PANC_MYCTU
[Raw transfer]




2DW_B_13(4MUL)
PANC_MYCTO
[Raw transfer]




GOL_C_20(3MUE)
PANC_SALTY
[Raw transfer]




BZ2_A_3(3IMG)
PANC_MYCTU
[Raw transfer]




2B5_B_11(3LE8)
PANC_MYCTU
[Raw transfer]




GOL_C_22(3MUE)
PANC_SALTY
[Raw transfer]




PAF_B_7(3Q12)
PANC_YERPE
[Raw transfer]




2DJ_B_6(4MUF)
PANC_MYCTO
[Raw transfer]




AMP_B_10(3UK2)
PANC_BURTA
[Raw transfer]




PAF_B_5(3GUZ)
PANC_ECOLI
[Raw transfer]




GOL_A_6(3MXT)
PANC_CAMJE
[Raw transfer]




PAF_D_10(3Q12)
PANC_YERPE
[Raw transfer]




AMP_A_5(3N8H)
PANC_FRATT
[Raw transfer]




AMP_D_14(3Q10)
PANC_YERPE
[Raw transfer]




A5D_B_6(3IOC)
PANC_MYCTU
[Raw transfer]




BZ2_B_8(3IME)
PANC_MYCTU
[Raw transfer]




BZ2_B_10(3IMG)
PANC_MYCTU
[Raw transfer]




2DV_B_12(4MUK)
PANC_MYCTO
[Raw transfer]




2DN_B_11(4MUH)
PANC_MYCTO
[Raw transfer]




GOL_A_6(3COW)
PANC_MYCTU
[Raw transfer]




EDO_A_9(4FZJ)
PANC_MYCTU
[Raw transfer]




EDO_B_5(1IHO)
PANC_ECOLI
[Raw transfer]




FG2_B_19(3IUB)
PANC_MYCTU
[Raw transfer]




A8D_A_10(3ISJ)
PANC_MYCTU
[Raw transfer]




2DN_A_5(4MUH)
PANC_MYCTO
[Raw transfer]




0HO_B_9(4DDM)
PANC_MYCTU
[Raw transfer]




GOL_A_4(3IVG)
PANC_MYCTU
[Raw transfer]




144_A_8(1V8F)
PANC_THET8
[Raw transfer]




EDO_A_4(1IHO)
PANC_ECOLI
[Raw transfer]




GOL_A_9(3COV)
PANC_MYCTU
[Raw transfer]




GOL_A_9(3COV)
PANC_MYCTU
[Raw transfer]




GOL_A_5(3IME)
PANC_MYCTU
[Raw transfer]




0HO_A_8(4DDM)
PANC_MYCTU
[Raw transfer]




FG3_B_18(3IUE)
PANC_MYCTU
[Raw transfer]




2DK_B_11(4MUG)
PANC_MYCTO
[Raw transfer]




A4D_A_3(3IOB)
PANC_MYCTU
[Raw transfer]




A4D_B_10(3IOB)
PANC_MYCTU
[Raw transfer]




2DZ_B_15(4MUN)
PANC_MYCTO
[Raw transfer]




2DK_A_7(4MUG)
PANC_MYCTO
[Raw transfer]




A8D_B_15(3ISJ)
PANC_MYCTU
[Raw transfer]




2DH_B_7(4MUE)
PANC_MYCTO
[Raw transfer]




2DZ_A_7(4MUN)
PANC_MYCTO
[Raw transfer]




0OC_B_10(4EFK)
PANC_MYCTU
[Raw transfer]




0OC_A_3(4EFK)
PANC_MYCTU
[Raw transfer]




0HN_B_7(4DDK)
PANC_MYCTU
[Raw transfer]




0HN_A_3(4DDK)
PANC_MYCTU
[Raw transfer]




0W1_B_12(4FZJ)
PANC_MYCTU
[Raw transfer]




ACY_B_10(3AG6)
PANC_STAA8
[Raw transfer]




I2E_B_17(4EF6)
PANC_MYCTU
[Raw transfer]




I2E_A_6(4EF6)
PANC_MYCTU
[Raw transfer]




MS0_A_5(4DDH)
PANC_MYCTU
[Raw transfer]




MS0_B_9(4DDH)
PANC_MYCTU
[Raw transfer]




BZ3_B_11(3IMC)
PANC_MYCTU
[Raw transfer]




FG6_A_4(3IVX)
PANC_MYCTU
[Raw transfer]




2DH_A_4(4MUE)
PANC_MYCTO
[Raw transfer]




FG2_A_11(3IUB)
PANC_MYCTU
[Raw transfer]




EOH_A_9(3IMC)
PANC_MYCTU
[Raw transfer]




FG3_A_4(3IUE)
PANC_MYCTU
[Raw transfer]




EOH_A_11(3COZ)
PANC_MYCTU
[Raw transfer]




2DW_A_9(4MUL)
PANC_MYCTO
[Raw transfer]




1 PsiBlast_PDB 93.5052%-121 - C6 -3MUE - PANC_SALTY -
24 PsiBlast_CBE 92.6252%-119 - C6 -1IHO 2.4 PANC_ECOLI
29 PsiBlast_CBE 92.6052%-116 - C6 -3Q10 6.0 PANC_YERPE
22 PsiBlast_CBE 92.3252%-119 - C6 -3MUE 3.2 PANC_SALTY
33 PsiBlast_CBE 92.0749%-113 - C6 -3INN 8.4 PANC_BRUME
108 HHSearch 91.9453%-112 - C6 -3Q12 2.7 PANC_YERPE
27 PsiBlast_CBE 91.8652%-115 - C6 -3Q12 2.8 PANC_YERPE
122 Fugue 91.7552%-117 - C6 -1IHO 3.2 PANC_ECOLI
2 PsiBlast_PDB 91.7552%-117 - C6 -1IHO - PANC_ECOLI -
4 PsiBlast_PDB 91.5552%-112 - C6 -3Q12 - PANC_YERPE -
21 PsiBlast_CBE 91.0152%-125 - C6 -3MUE - PANC_SALTY -
30 PsiBlast_CBE 90.9952%-114 - C6 -3Q10 6.4 PANC_YERPE
25 PsiBlast_CBE 90.9452%-118 - C6 -3Q12 2.8 PANC_YERPE
26 PsiBlast_CBE 90.8452%-113 - C6 -3Q12 2.7 PANC_YERPE
3 PsiBlast_PDB 90.5852%-112 - C6 -3Q10 - PANC_YERPE -
7 PsiBlast_PDB 90.3249%-114 - C6 -3INN - PANC_BRUME -
23 PsiBlast_CBE 89.9952%-115 - C6 -3MUE 3.1 PANC_SALTY
102 HHSearch 89.4548%-111 - C6 -3INN 7.5 PANC_BRUME
9 PsiBlast_PDB 88.9045%-121 - C6 -3UK2 - PANC_BURTA -
106 HHSearch 88.5347%-120 - C6 -3UK2 6.5 PANC_BURTA
34 PsiBlast_CBE 88.1745%-122 - C6 -3UK2 6.5 PANC_BURTA
103 HHSearch 87.3648%-110 - C6 -3COV 2.9 PANC_MYCTU
32 PsiBlast_CBE 87.3549%-119 - C6 -3INN 7.6 PANC_BRUME
104 HHSearch 87.2739%-110 - C6 -3MXT 2.1 PANC_CAMJE
109 HHSearch 87.2352%-109 - C6 -1V8F 2.3 PANC_THET8
19 PsiBlast_PDB 85.5548%-111 - C6 -3IMC 3.2 PANC_MYCTU
96 PsiBlast_CBE 85.4648%-110 - C6 -4EF6 4.8 PANC_MYCTU
43 PsiBlast_CBE 85.1948%-110 - C6 -4DE5 3.9 PANC_MYCTU
67 PsiBlast_CBE 85.1548%-110 - C6 -3IOB 6.2 PANC_MYCTU
31 PsiBlast_CBE 84.8952%-101 - C6 -1V8F 2.7 PANC_THET8
69 PsiBlast_CBE 84.7948%-110 - C6 -3IMG 3.1 PANC_MYCTU
18 PsiBlast_PDB 84.7948%-110 - C6 -3COZ 3.2 PANC_MYCTU
59 PsiBlast_CBE 84.5648%-108 - C6 -3IUB 3.7 PANC_MYCTU
41 PsiBlast_CBE 84.4148%-108 - C6 -4FZJ 2.2 PANC_MYCTU
61 PsiBlast_CBE 84.4048%-110 - C6 -3IOE 7.7 PANC_MYCTU
39 PsiBlast_CBE 84.3848%-109 - C6 -4G5Y 9.2 PANC_MYCTU
78 PsiBlast_CBE 84.2848%-110 - C6 -4MUL 8.6 PANC_MYCTO
101 HHSearch 84.2440%-108 - C6 -3AG6 9.0 PANC_STAA8
45 PsiBlast_CBE 84.2448%-107 - C6 -4DDM 2.8 PANC_MYCTU
16 PsiBlast_PDB 84.1648%-110 - C6 -3COV 2.9 PANC_MYCTU
57 PsiBlast_CBE 84.1248%-108 - C6 -3IUE 3.0 PANC_MYCTU
86 PsiBlast_CBE 84.0648%-110 - C6 -4MUH 6.8 PANC_MYCTO
53 PsiBlast_CBE 84.0648%-110 - C6 -3IVG 2.9 PANC_MYCTU
47 PsiBlast_CBE 84.0648%-110 - C6 -4DDK 4.2 PANC_MYCTU
17 PsiBlast_PDB 84.0048%-109 - C6 -3COW 2.9 PANC_MYCTU
55 PsiBlast_CBE 83.8948%-113 - C6 -3IVC 7.0 PANC_MYCTU
51 PsiBlast_CBE 83.8848%-108 - C6 -3IVX 3.1 PANC_MYCTU
81 PsiBlast_CBE 83.8348%-121 - C6 -4MUJ 8.0 PANC_MYCTO
72 PsiBlast_CBE 83.5248%-116 - C6 -3COY 8.8 PANC_MYCTU
82 PsiBlast_CBE 83.5148%-111 - C6 -4MUJ 8.4 PANC_MYCTO
88 PsiBlast_CBE 83.4348%-108 - C6 -4MUG 6.9 PANC_MYCTO
49 PsiBlast_CBE 83.4248%-109 - C6 -4DDH 4.6 PANC_MYCTU
20 PsiBlast_PDB 83.3348%-112 - C6 -3IME 2.8 PANC_MYCTU
58 PsiBlast_CBE 83.2148%-117 - C6 -3IUB 6.3 PANC_MYCTU
92 PsiBlast_CBE 83.1348%-117 - C6 -4MUE 3.5 PANC_MYCTO
100 PsiBlast_CBE 83.0148%-111 - C6 -3ISJ 5.1 PANC_MYCTU
73 PsiBlast_CBE 82.7248%-114 - C6 -3COW 9.4 PANC_MYCTU
56 PsiBlast_CBE 82.5648%-118 - C6 -3IUE 6.7 PANC_MYCTU
46 PsiBlast_CBE 82.5348%-115 - C6 -4DDK 4.1 PANC_MYCTU
63 PsiBlast_CBE 82.4748%-111 - C6 -3IOD 7.9 PANC_MYCTU
79 PsiBlast_CBE 82.4248%-122 - C6 -4MUK 9.0 PANC_MYCTO
77 PsiBlast_CBE 82.3748%-122 - C6 -4MUL 7.8 PANC_MYCTO
74 PsiBlast_CBE 82.3648%-115 - C6 -3COV 2.6 PANC_MYCTU
84 PsiBlast_CBE 82.3248%-116 - C6 -4MUI 7.7 PANC_MYCTO
93 PsiBlast_CBE 82.3148%-119 - C6 -4EFK 2.8 PANC_MYCTU
60 PsiBlast_CBE 81.9348%-115 - C6 -3IOE 7.7 PANC_MYCTU
38 PsiBlast_CBE 81.8648%-119 - C6 -4G5Y 9.1 PANC_MYCTU
76 PsiBlast_CBE 81.8348%-109 - C6 -4MUN 4.9 PANC_MYCTO
75 PsiBlast_CBE 81.8348%-120 - C6 -4MUN 7.2 PANC_MYCTO
62 PsiBlast_CBE 81.7748%-120 - C6 -3IOD 9.7 PANC_MYCTU
85 PsiBlast_CBE 81.5848%-120 - C6 -4MUH 5.7 PANC_MYCTO
94 PsiBlast_CBE 81.5648%-111 - C6 -4EFK 3.4 PANC_MYCTU
99 PsiBlast_CBE 81.4848%-120 - C6 -3ISJ 5.1 PANC_MYCTU
80 PsiBlast_CBE 81.4148%-116 - C6 -4MUK 8.0 PANC_MYCTO
40 PsiBlast_CBE 81.3548%-118 - C6 -4FZJ 4.4 PANC_MYCTU
95 PsiBlast_CBE 81.3048%-116 - C6 -4EF6 4.4 PANC_MYCTU
48 PsiBlast_CBE 81.2848%-116 - C6 -4DDH 5.0 PANC_MYCTU
44 PsiBlast_CBE 81.1248%-118 - C6 -4DDM 3.0 PANC_MYCTU
87 PsiBlast_CBE 81.1148%-117 - C6 -4MUG 6.3 PANC_MYCTO
97 PsiBlast_CBE 81.0848%-122 * C6 *3LE8 8.4 PANC_MYCTU
68 PsiBlast_CBE 80.9748%-119 - C6 -3IMG 3.0 PANC_MYCTU
71 PsiBlast_CBE 80.8548%-117 - C6 -3IMC 4.2 PANC_MYCTU
50 PsiBlast_CBE 80.7848%-117 - C6 -3IVX 7.6 PANC_MYCTU
70 PsiBlast_CBE 80.6948%-118 - C6 -3IME 3.4 PANC_MYCTU
89 PsiBlast_CBE 80.6048%-119 - C6 -4MUF 7.7 PANC_MYCTO
66 PsiBlast_CBE 80.2848%-116 - C6 -3IOB 6.3 PANC_MYCTU
64 PsiBlast_CBE 79.8948%-116 - C6 -3IOC 8.4 PANC_MYCTU
83 PsiBlast_CBE 79.7948%-119 - C6 -4MUI 7.0 PANC_MYCTO
90 PsiBlast_CBE 79.7448%-111 - C6 -4MUF 8.0 PANC_MYCTO
42 PsiBlast_CBE 79.5448%-115 - C6 -4DE5 4.1 PANC_MYCTU
52 PsiBlast_CBE 79.5148%-118 - C6 -3IVG 7.4 PANC_MYCTU
65 PsiBlast_CBE 79.1948%-114 - C6 -3IOC 8.1 PANC_MYCTU
35 PsiBlast_CBE 79.0341%-103 - C6 -2X3F 8.6 PANC_STAAR
91 PsiBlast_CBE 78.5748%-118 - C6 -4MUE 7.7 PANC_MYCTO
107 HHSearch 77.3439%-104 - C6 -3N8H 6.3 PANC_FRATT
28 PsiBlast_CBE 76.4352%-127 - C6 -3Q10 5.5 PANC_YERPE
37 PsiBlast_CBE 75.0656%-136 - C6 -3GUZ 2.7 PANC_ECOLI
36 PsiBlast_CBE 73.3548%-112 - C6 -3AG6 9.1 PANC_STAA8