@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : FRK_HUMAN: (2017-06-02 )
WFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY

Atome Classification :

(102 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_I_3(1BHF)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




687_B_2(1O45)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




903_B_2(1O46)

[Raw transfer]




821_B_2(1O43)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




300_B_2(1O41)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

ACE_B_3(1LKL)
?
[Raw transfer]




CHAIN_D_4(1A07)

[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_D_2(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(3WA4)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

266 HHSearch 88.9185%-163 - C1 -2DLY Calc...
1 PsiBlast_PDB 88.6384%-163 - C1 -2DLY - -
195 PsiBlast_CBE 79.4246%-157 - C1 -1JYR - GRB2_HUMAN -
135 PsiBlast_CBE 79.3546%-165 - C1 -4P9V - GRB2_HUMAN -
144 PsiBlast_CBE 79.3346%-170 - C1 -3IN7 - GRB2_HUMAN -
147 PsiBlast_CBE 79.2546%-168 - C1 -3IMJ - GRB2_HUMAN -
156 PsiBlast_CBE 79.1246%-154 - C1 -1BMB - GRB2_HUMAN -
198 PsiBlast_CBE 79.1146%-154 - C1 -3WA4 - GRB2_HUMAN -
197 PsiBlast_CBE 79.0946%-156 - C1 -1JYQ - GRB2_HUMAN -
193 PsiBlast_CBE 79.0346%-163 * C1 *3MXY - GRB2_HUMAN -
141 PsiBlast_CBE 78.9646%-158 - C1 -3N8M - GRB2_HUMAN -
179 PsiBlast_CBE 78.5846%-147 - C1 -1TZE - GRB2_HUMAN -
139 PsiBlast_CBE 78.4646%-166 - C1 -3OVE - GRB2_HUMAN -
137 PsiBlast_CBE 78.4446%-156 - C1 -3S8N - GRB2_HUMAN -
159 PsiBlast_CBE 78.4046%-155 - C1 -2HUW - GRB2_HUMAN -
145 PsiBlast_CBE 78.3146%-164 - C1 -3IN7 - GRB2_HUMAN -
196 PsiBlast_CBE 78.2546%-158 - C1 -1JYQ - GRB2_HUMAN -
136 PsiBlast_CBE 78.0746%-155 - C1 -3S8O - GRB2_HUMAN -
157 PsiBlast_CBE 78.0446%-154 - C- -1BM2 - GRB2_HUMAN -
155 PsiBlast_CBE 78.0446%-166 - C1 -3N84 - GRB2_HUMAN -
271 HHSearch 77.4047%-156 - C1 -3WA4 7.9 GRB2_HUMAN
54 PsiBlast_CBE 72.6156% -37 - C1 -1X27 5.6 ?
56 PsiBlast_CBE 72.4356% -18 - C1 -1X27 6.2 ?
61 PsiBlast_CBE 72.3655% -45 - C1 -1IJR 8.2 LCK_HUMAN
55 PsiBlast_CBE 72.3656% -26 - C1 -1X27 4.2 ?
53 PsiBlast_CBE 72.3356% -13 - C1 -1X27 5.0 ?
270 HHSearch 72.0560% -20 - C1 -1LKK 7.0 LCK_HUMAN
57 PsiBlast_CBE 71.3956% -20 - C1 -1X27 4.2
48 PsiBlast_CBE 70.9356% -20 - C1 -1LKK 7.0 LCK_HUMAN
63 PsiBlast_CBE 70.8855% -42 - C1 -1FBZ 5.7 LCK_HUMAN
119 PsiBlast_CBE 70.7348% -21 - C1 -1A09 5.4
52 PsiBlast_CBE 70.6556% -27 - C1 -1X27 5.0 ?
121 PsiBlast_CBE 70.4148% -27 - C1 -1A08 6.1
60 PsiBlast_CBE 70.3456% -30 - C1 -1CWD 4.1 ?
117 PsiBlast_CBE 70.1548% -27 - C1 -1A1B 5.6
68 PsiBlast_CBE 69.8349% -10 - C1 -1A1A 6.4
113 PsiBlast_CBE 69.5448% -21 - C1 -1A1E 6.6
115 PsiBlast_CBE 69.4248% -25 - C1 -1A1C 7.2
92 PsiBlast_CBE 69.2048% -20 - C1 -1O4L 3.8
44 PsiBlast_CBE 69.1356% -21 - C1 -1LCJ 4.6 LCK_HUMAN
50 PsiBlast_CBE 69.0656% -12 - C1 -1LKL 4.0 ?
123 PsiBlast_CBE 68.9548% -18 - C1 -1A07 3.3
122 PsiBlast_CBE 68.9548% -23 - C1 -1A08 5.6 SRC_HUMAN
78 PsiBlast_CBE 68.9549% -21 - C1 -1SHA 6.7
77 PsiBlast_CBE 68.9049% -19 - C1 -1SHB 4.0
96 PsiBlast_CBE 68.8448% -16 - C1 -1O4H 3.9
105 PsiBlast_CBE 68.8048% -14 - C1 -1O45 6.7
69 PsiBlast_CBE 68.7949% -13 - C1 -1A1A 4.8 SRC_HUMAN
124 PsiBlast_CBE 68.5148% -30 - C1 -1A07 3.7 SRC_HUMAN
106 PsiBlast_CBE 68.3948% -17 - C1 -1O44 8.5
62 PsiBlast_CBE 68.3855% -46 - C1 -1FBZ 6.1 ?
110 PsiBlast_CBE 68.1048% -42 - C1 -1SHD 6.0
59 PsiBlast_CBE 68.0456% -34 - C1 -1CWE 5.1 ?
114 PsiBlast_CBE 67.8948% -32 - C1 -1A1E 7.1 SRC_HUMAN
116 PsiBlast_CBE 67.7648% -16 - C1 -1A1C 6.8 SRC_HUMAN
71 PsiBlast_CBE 67.6949% -21 - C1 -1IS0 4.5
58 PsiBlast_CBE 67.5556% -32 - C1 -1CWE 4.5 ?
93 PsiBlast_CBE 67.5448% -22 - C1 -1O4K 3.4
118 PsiBlast_CBE 67.4548% -24 - C1 -1A1B 6.2 SRC_HUMAN
107 PsiBlast_CBE 67.4348% -12 - C1 -1O43 6.0
108 PsiBlast_CBE 67.4148% -9 - C1 -1O42 6.9
47 PsiBlast_CBE 67.3856% -25 - C1 -1BHF 4.9
85 PsiBlast_CBE 67.3249% -18 - C1 -1SKJ 7.0
95 PsiBlast_CBE 67.2348% -22 - C1 -1O4I 2.5
74 PsiBlast_CBE 67.1149% -16 - C1 -1SPS 4.2 SRC_RSVSA
49 PsiBlast_CBE 67.0256% -20 - C1 -1LCK 3.4 LCK_HUMAN
120 PsiBlast_CBE 66.7448% -26 - C1 -1A09 5.4 SRC_HUMAN
75 PsiBlast_CBE 66.7249% -11 - C1 -1SPS 4.3 SRC_RSVSA
129 PsiBlast_CBE 66.6748% -20 - C1 -1F1W 5.7
83 PsiBlast_CBE 66.5549% -36 - C1 -1P13 5.3
84 PsiBlast_CBE 66.5149% -23 - C1 -1P13 6.0 SRC_CHICK
130 PsiBlast_CBE 66.4846% -79 - C1 -1KC2 5.9
99 PsiBlast_CBE 66.4748% -11 - C1 -1O4B 5.9
91 PsiBlast_CBE 66.3748% -21 - C1 -1O4M 3.0
103 PsiBlast_CBE 66.3248% -6 - C1 -1O47 7.6
102 PsiBlast_CBE 66.2948% -15 - C1 -1O48 8.2
132 PsiBlast_CBE 66.2548% -14 - C1 -1O4F 2.3
72 PsiBlast_CBE 66.2249% -26 - C1 -1IS0 5.0 SRC_RSVSA
100 PsiBlast_CBE 66.0948% -15 - C1 -1O4A 6.8
109 PsiBlast_CBE 66.0448% -22 - C1 -1O41 2.5
125 PsiBlast_CBE 65.5949% -18 - C1 -1BKM 6.1
89 PsiBlast_CBE 65.5648% -15 - C1 -1O4O 2.9
88 PsiBlast_CBE 65.4848% -8 - C1 -1O4P 4.7
87 PsiBlast_CBE 65.4548% -17 - C1 -1O4Q 3.9
81 PsiBlast_CBE 65.3749% -23 - C1 -1NZL 5.8
79 PsiBlast_CBE 65.1349% -18 - C1 -1NZV 6.8
131 PsiBlast_CBE 65.0548% -17 - C1 -1O4G 3.9
101 PsiBlast_CBE 65.0348% -14 - C1 -1O49 6.4
97 PsiBlast_CBE 64.8748% -20 - C1 -1O4E 2.7
86 PsiBlast_CBE 64.8348% -24 - C1 -1O4R 5.0
73 PsiBlast_CBE 64.6149% 6 - C1 -1SPS 3.6
104 PsiBlast_CBE 64.4348% -11 - C1 -1O46 7.7
112 PsiBlast_CBE 64.0148% -20 - C1 -1HCS 3.9
90 PsiBlast_CBE 64.0048% -18 - C1 -1O4N 3.4
98 PsiBlast_CBE 63.8748% -14 - C1 -1O4D 2.8
94 PsiBlast_CBE 63.1048% -16 - C1 -1O4J 2.9
111 PsiBlast_CBE 61.8748% -18 - C1 -1HCT 3.1
281 Fugue 60.0059% 97 - C1 -1LKK 7.6 LCK_HUMAN
45 PsiBlast_CBE 56.9253% 17 - C1 -1AOU 4.7
46 PsiBlast_CBE 54.7853% 15 - C1 -1AOT 2.0
267 HHSearch 51.3931%-104 - C1 -3PQZ 2.4 GRB7_HUMAN
43 PsiBlast_CBE 47.5753% -13 - C1 -4U17 3.2 FYN_HUMAN