@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_1104: (2015-12-20 )
MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS

Atome Classification :

(69 SA) .........10........20........30.....-...40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDA-KEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS
12 PsiBlast_PDB 96.4454%-127 - C2 -1K9S DEOD_ECOLI A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
66 PsiBlast_CBE 96.0354%-131 - C2 -3OOH DEOD_ECOLI F:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
87 PsiBlast_CBE 95.7354%-126 - C2 -1K9S DEOD_ECOLI C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
20 PsiBlast_PDB 95.5354%-123 - C2 -4RJ2 ? A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
41 PsiBlast_CBE 95.5254%-127 - C2 -4TS3 ? F:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
27 PsiBlast_CBE 95.5054%-128 - C2 -1PR4 DEOD_ECO57 C:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTT---RQTTFNDMIKIALESVL
50 PsiBlast_CBE 95.3954%-123 - C2 -4RJ2 ? C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
97 PsiBlast_CBE 95.3653%-126 - C2 -1OUM DEOD_ECOLI A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGVGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
77 PsiBlast_CBE 95.3454%-126 - C2 -3ONV DEOD_ECOLI B:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
71 PsiBlast_CBE 95.3354%-129 - C2 -3OOE DEOD_ECOLI F:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
88 PsiBlast_CBE 95.3054%-128 - C2 -1K9S DEOD_ECOLI B:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
53 PsiBlast_CBE 95.2654%-125 - C2 -3UT6 DEOD_ECOLI B:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
38 PsiBlast_CBE 95.2554%-126 - C2 -1OTY DEOD_ECOLI B:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
16 PsiBlast_PDB 95.2354%-126 - C2 -3ONV DEOD_ECOLI A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
46 PsiBlast_CBE 95.2154%-126 - C2 -4TS3 ? A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
18 PsiBlast_PDB 95.1354%-129 - C2 -3OOH DEOD_ECOLI A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
17 PsiBlast_PDB 95.0854%-125 - C2 -3OOE DEOD_ECOLI A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
74 PsiBlast_CBE 95.0554%-128 - C2 -3OOE DEOD_ECOLI C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSD------------RQTTFNDMIKIALESVL
14 PsiBlast_PDB 95.0254%-124 - C2 -1PK9 DEOD_ECO57 A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
80 PsiBlast_CBE 94.9654%-127 - C2 -1PK9 DEOD_ECO57 C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
19 PsiBlast_PDB 94.8654%-125 - C2 -3UT6 DEOD_ECOLI A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
7 PsiBlast_PDB 94.7754%-125 - C2 -1PW7 DEOD_ECO57 A:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
6 PsiBlast_PDB 94.6754%-129 - C2 -1PR6 DEOD_ECO57 A:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIR---QTTAAERQTTFNDMIKIALESVL
28 PsiBlast_CBE 94.5154%-124 - C2 -1PR4 DEOD_ECO57 B:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
4 PsiBlast_PDB 94.4354%-128 - C2 -1PR4 DEOD_ECO57 A:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHI-----TTAAERQTTFNDMIKIALESVL
52 PsiBlast_CBE 94.3654%-125 - C2 -3UT6 DEOD_ECOLI C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
23 PsiBlast_CBE 94.3654%-131 - C2 -1PR6 DEOD_ECO57 C:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQT-----QTTFNDMIKIALESVL
82 PsiBlast_CBE 94.2454%-130 - C2 -1PK7 DEOD_ECO57 C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
81 PsiBlast_CBE 94.0654%-124 - C2 -1PK9 DEOD_ECO57 B:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
15 PsiBlast_PDB 94.0654%-124 - C2 -1PKE DEOD_ECO57 A:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
3 PsiBlast_PDB 94.0654%-123 - C2 -1PR2 DEOD_ECO57 A:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
1 PsiBlast_PDB 94.0654%-124 - C2 -1PR0 DEOD_ECO57 A:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
102 PsiBlast_CBE 93.9953%-123 - C2 -4TS9 ? B:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVASCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
36 PsiBlast_CBE 93.9854%-125 - C2 -1OU4 DEOD_ECOLI B:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
89 PsiBlast_CBE 93.9453%-128 - C2 -1OVG DEOD_ECOLI C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGVGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
24 PsiBlast_CBE 93.9054%-125 - C2 -1PR6 DEOD_ECO57 B:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHI----QTTAAERQTTFNDMIKIALESVL
93 PsiBlast_CBE 93.8253%-123 - C2 -1OV6 DEOD_ECOLI B:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGVGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
29 PsiBlast_CBE 93.8254%-122 - C2 -1PR2 DEOD_ECO57 C:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
39 PsiBlast_CBE 93.7954%-131 - C2 -1A69 DEOD_ECOLI C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIR----TTAAERQTTFNDMIKIALESVL
95 PsiBlast_CBE 93.6953%-127 - C2 -1OUM DEOD_ECOLI C:[2-230] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGVGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL
22 PsiBlast_CBE 93.6154%-126 - C2 -1PW7 DEOD_ECO57 B:[3-231] -TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDA-REVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL