@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0131: (2016-03-12 )
MDISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLVRLKTATTILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTFLHDYVKEHLKYPECLEIEIIERGEITELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAYLRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLREMKVDYFQGYYFSRPLPMEEIKQKYSIV

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

C2E_A_3(3GG0)
?
[Raw transfer]




C2E_A_4(3GFX)
?
[Raw transfer]




C2E_A_3(3GFZ)
?
[Raw transfer]




C2E_A_3(3GFY)
?
[Raw transfer]




EDO_A_7(4Q6J)
?
[Raw transfer]




1 PsiBlast_PDB 99.7397%-127 - C4 -4Q6J 3.3 ?
47 Fugue 75.9528% -90 - C4 -3SY8 - ? -
28 HHSearch 74.2928% -85 - C4 -2R6O - ? -
4 PsiBlast_PDB 74.2730% -93 - C4 -4RNH - ? -
13 PsiBlast_PDB 73.2226% -89 - C4 -4HJF - ? -
25 HHSearch 73.0627% -94 - C4 -3S83 - ? -
30 HHSearch 72.5428% -84 - C4 -3SY8 - ? -
2 PsiBlast_PDB 71.5631% -91 - C4 -4RNI - ? -
3 PsiBlast_PDB 70.6231% -94 - C4 -4RNJ - ? -
5 PsiBlast_PDB 70.3729% -88 - C4 -4RNF - ? -
9 PsiBlast_PDB 69.6830% -90 - C4 -3N3T - ? -
8 PsiBlast_PDB 69.5730% -89 - C4 -2R6O - ? -
12 PsiBlast_PDB 69.5127% -95 - C4 -3S83 - ? -
11 PsiBlast_PDB 69.1627% -81 - C4 -3U2E - ? -
16 PsiBlast_PDB 67.0227% -92 - C4 -4LYK - YAHA_ECOLI -
6 PsiBlast_PDB 66.9831% -93 - C4 -4HU3 - -
7 PsiBlast_PDB 66.6731% -98 - C4 -4HU4 - DOSP_ECOLI -
14 PsiBlast_PDB 66.6127% -86 - C4 -4KIE - YAHA_ECOLI -
27 HHSearch 65.4019% -83 * C4 *3HV8 - ? -
15 PsiBlast_PDB 65.2527% -85 - C4 -4LJ3 - YAHA_ECOLI -
20 PsiBlast_PDB 59.4330% -76 - C4 -3GG0 6.3 ?
17 PsiBlast_PDB 59.2330% -69 - C4 -3GFX 9.4 ?
19 PsiBlast_PDB 58.7430% -73 - C4 -3GFZ 7.4 ?
18 PsiBlast_PDB 56.4330% -84 - C4 -3GFY 9.0 ?