@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1152: (2016-03-22 )
MSEKAVQLTEFVGTAIGDTIGLVIANVDGQLLEAMKLEKSYRSIGILGARTGAGPHIMAADEAVKATNTEVVKIELPRDTKGGAGHGSLIIFGGDDVSDVKRAVEVALNELDKTFGDVYGNEAGHIELQYTARASHALEKAFGAPVGKAFGLMVGAPAGIGVVMADTAVKSANVDVVAYSSPADGTSFSNEVILCISGDSGAVRQAVISAREIGKKLLGALGDEPKNDRPSYI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_13(4FAY)
?
[Raw transfer]




GOL_A_6(4FAY)
?
[Raw transfer]




GOL_C_21(4FAY)
?
[Raw transfer]




GOL_B_14(4FAY)
?
[Raw transfer]




GOL_A_7(4FAY)
?
[Raw transfer]




22 PsiBlast_CBE 98.0859% -88 - C5 -4FAY 3.2 ?
21 PsiBlast_CBE 97.4859% -89 - C5 -4FAY 2.0 ?
1 PsiBlast_PDB 97.0759% -88 - C5 -4FAY 3.1 ?
2 PsiBlast_PDB 94.9459% -88 - C5 -4I61 - ? -
3 PsiBlast_PDB 92.0656% -82 - C5 -3IO0 - ? -
41 HHSearch 88.0754% -86 - C5 -3IO0 - ? -
42 HHSearch 60.6124% -85 - C5 -3GFH - EUTL_ECOLI -
62 Fugue 59.7622% -87 - C5 -3GFH - EUTL_ECOLI -
9 PsiBlast_PDB 57.4426% -68 - C5 -4U6I - ? -
12 PsiBlast_PDB 55.8526% -72 - C5 -4TLH - ? -
11 PsiBlast_PDB 55.7626% -73 - C5 -4TME - ? -
44 HHSearch 55.1021% -81 - C5 -3N79 - ? -
43 HHSearch 55.0223% -85 - C5 -3NWG - ? -
10 PsiBlast_PDB 54.1926% -71 - C5 -4TM6 - ? -
6 PsiBlast_PDB 51.9928% -79 - C5 -3GFH - EUTL_ECOLI -
5 PsiBlast_PDB 50.8328% -77 - C5 -3I87 - EUTL_ECOLI -
4 PsiBlast_PDB 50.1528% -71 - C5 -3I82 - EUTL_ECOLI -
8 PsiBlast_PDB 49.6227% -63 - C5 -3U27 - ? -
7 PsiBlast_PDB 49.2028% -87 - C5 -3MPV - EUTL_ECOLI -
13 PsiBlast_PDB 46.4234% -90 - C5 -3PAC - ? -