@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0023: (2015-11-27 )
MNNQLIYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGNHMDKDVFRRDLGSLTDVYQVVLEKLIAL

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AIR_A_3(4FE2)
PUR7_STRPN
[Raw transfer]




ADP_B_8(3NUA)
PUR7_CLOP1
[Raw transfer]




AMP_A_11(4O81)
PUR7_PYRHO
[Raw transfer]




C5P_A_2(4O7Y)
PUR7_PYRHO
[Raw transfer]




TYD_A_2(4O7S)
PUR7_PYRHO
[Raw transfer]




U5P_A_2(4O7R)
PUR7_PYRHO
[Raw transfer]




ADP_A_3(4O7V)
PUR7_PYRHO
[Raw transfer]




ATP_A_7(2Z02)
PUR7_METJA
[Raw transfer]




ATP_A_3(4O7W)
PUR7_PYRHO
[Raw transfer]




ATP_B_6(2Z02)
PUR7_METJA
[Raw transfer]




ADP_A_3(4O7T)
PUR7_PYRHO
[Raw transfer]




EDO_A_7(3KRE)
PUR7_EHRCR
[Raw transfer]




ADP_A_4(4NYE)
PUR7_STRPN
[Raw transfer]




ADP_A_4(4FGR)
PUR7_STRPN
[Raw transfer]




ADP_A_12(2YWV)
?
[Raw transfer]




ADP_B_13(2YWV)
?
[Raw transfer]




ADP_A_2(4O7L)
PUR7_PYRHO
[Raw transfer]




ADP_A_3(3NUA)
PUR7_CLOP1
[Raw transfer]




ADP_A_4(2YZL)
PUR7_METJA
[Raw transfer]




ADP_B_12(4FE2)
PUR7_STRPN
[Raw transfer]




EDO_A_6(3KRE)
PUR7_EHRCR
[Raw transfer]




ADP_A_5(4O7N)
PUR7_PYRHO
[Raw transfer]




ADP_B_8(4NYE)
PUR7_STRPN
[Raw transfer]




ADP_B_8(4FGR)
PUR7_STRPN
[Raw transfer]




ADP_A_8(4O86)
PUR7_PYRHO
[Raw transfer]




ADP_A_10(4O82)
PUR7_PYRHO
[Raw transfer]




AMP_A_10(4O81)
PUR7_PYRHO
[Raw transfer]




2 PsiBlast_PDB 98.7979% -81 - C3 -4FGR 7.0 PUR7_STRPN
3 PsiBlast_PDB 97.9379% -79 - C3 -4NYE 7.0 PUR7_STRPN
1 PsiBlast_PDB 96.4179% -77 - C3 -4FE2 5.1 PUR7_STRPN
23 PsiBlast_CBE 95.9579% -75 - C3 -4FE2 6.2 PUR7_STRPN
21 PsiBlast_CBE 93.9679% -78 - C3 -4NYE 6.1 PUR7_STRPN
22 PsiBlast_CBE 93.7879% -78 - C3 -4FGR 6.4 PUR7_STRPN
39 HHSearch 88.2157% -70 - C3 -2YWV - ? -
24 PsiBlast_CBE 87.8857% -66 - C3 -2YWV 7.0 ?
4 PsiBlast_PDB 87.5657% -71 - C3 -2YWV 6.8 ?
16 PsiBlast_PDB 84.2945% -67 - C3 -2YZL 6.3 PUR7_METJA
7 PsiBlast_PDB 83.7348% -65 - C3 -4O7L 6.0 PUR7_PYRHO
40 HHSearch 83.6346% -73 * C3 *3U55 - PUR7_PYRHO -
6 PsiBlast_PDB 82.7748% -71 - C3 -3U55 - PUR7_PYRHO -
27 PsiBlast_CBE 82.4843% -74 - C3 -3KRE 3.2 PUR7_EHRCR
10 PsiBlast_PDB 82.4248% -81 - C3 -4O7S 6.3 PUR7_PYRHO
13 PsiBlast_PDB 82.3448% -67 - C3 -4O7W 5.5 PUR7_PYRHO
25 PsiBlast_CBE 82.1751% -61 - C3 -3NUA 6.4 PUR7_CLOP1
35 HHSearch 82.1145% -68 - C3 -2Z02 - PUR7_METJA -
8 PsiBlast_PDB 82.1048% -66 - C3 -4O7N 6.4 PUR7_PYRHO
14 PsiBlast_PDB 81.9748% -71 - C3 -4O7Y 5.6 PUR7_PYRHO
11 PsiBlast_PDB 81.9248% -72 - C3 -4O7T 5.1 PUR7_PYRHO
26 PsiBlast_CBE 81.8645% -69 - C3 -2Z02 6.9 PUR7_METJA
15 PsiBlast_PDB 81.8348% -73 - C3 -4O86 6.0 PUR7_PYRHO
12 PsiBlast_PDB 81.7448% -70 - C3 -4O7V 5.5 PUR7_PYRHO
19 PsiBlast_PDB 81.7048% -72 - C3 -4O81 6.5 PUR7_PYRHO
17 PsiBlast_PDB 81.6745% -69 - C3 -2Z02 6.5 PUR7_METJA
5 PsiBlast_PDB 80.8451% -63 - C3 -3NUA 8.2 PUR7_CLOP1
9 PsiBlast_PDB 80.4448% -63 - C3 -4O7R 5.7 PUR7_PYRHO
20 PsiBlast_PDB 79.7548% -74 - C3 -4O82 5.4 PUR7_PYRHO