@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1197: (2016-01-27 )
MDSHSPIATVAQALRRAERILVITGAGLSADSGMPTYRGLGGLYNGRTEEGLPIEAALSGPMLRRDPALCWKYLAELGKACLAARPNAGHEAIAELQKHKPECWVLTQNIDGFHRQAGSPAERLIEIHGELAPLYCQSCGAESGGLEEHLHGQLPPRCAACGGVLRPPVVLFEEMLPEEAIDTLYRELRKGFDAVLVVGTTASFPYIVEPVLRTRQAGGFTAEVNPGVTDLSERVDVKMTGRALDIMPQVVSHIYR

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

APR_A_3(1M2J)
NPD1_ARCFU
[Raw transfer]




APR_A_3(1M2G)
NPD1_ARCFU
[Raw transfer]




APR_A_3(1M2H)
NPD1_ARCFU
[Raw transfer]




NAD_B_8(3RIY)
SIR5_HUMAN
[Raw transfer]




CNA_A_6(4G1C)
SIR5_HUMAN
[Raw transfer]




OAD_B_5(1M2N)
NPD1_ARCFU
[Raw transfer]




APR_A_3(1M2K)
NPD1_ARCFU
[Raw transfer]




OAD_B_5(1M2N)
NPD1_ARCFU
[Raw transfer]




NAD_C_26(1YC2)
NPD2_ARCFU
[Raw transfer]




NAD_B_25(1YC2)
NPD2_ARCFU
[Raw transfer]




NX6_D_12(4UUA)
SIR5_DANRE
[Raw transfer]




EPE_B_6(4UTV)
SIR5_DANRE
[Raw transfer]




WOC_A_5(4UU8)
SIR5_DANRE
[Raw transfer]




EDO_B_8(4UTN)
SIR5_DANRE
[Raw transfer]




EDO_A_5(4UTX)
SIR5_DANRE
[Raw transfer]




EDO_B_10(4UUB)
SIR5_DANRE
[Raw transfer]




EDO_B_9(4UU8)
SIR5_DANRE
[Raw transfer]




EDO_B_9(4UTZ)
SIR5_DANRE
[Raw transfer]




FSL_C_9(4UTV)
SIR5_DANRE
[Raw transfer]




0L1_D_10(4UTZ)
SIR5_DANRE
[Raw transfer]




EPE_A_13(2B4Y)
SIR5_HUMAN
[Raw transfer]




NCA_A_4(1YC5)
NPD_THEMA
[Raw transfer]




EDO_B_9(4UUA)
SIR5_DANRE
[Raw transfer]




EDO_B_10(4UTX)
SIR5_DANRE
[Raw transfer]




SU8_D_11(4UUB)
SIR5_DANRE
[Raw transfer]




EDO_A_5(4UTR)
SIR5_DANRE
[Raw transfer]




EDO_B_10(4UU7)
SIR5_DANRE
[Raw transfer]




STL_B_6(4HDA)
SIR5_HUMAN
[Raw transfer]




10 PsiBlast_PDB 89.0636%-102 - C4 -4TWJ - NPD2_ARCFU -
23 PsiBlast_CBE 88.3836% -94 - C4 -1YC2 - NPD2_ARCFU -
107 HHSearch 88.3734% -96 - C4 -3RIY - SIR5_HUMAN -
26 PsiBlast_CBE 87.8336% -95 - C4 -1YC2 6.4 NPD2_ARCFU
27 PsiBlast_CBE 87.4436% -87 - C4 -1S7G - NPD2_ARCFU -
29 PsiBlast_CBE 87.4136% -94 - C4 -1S7G - NPD2_ARCFU -
25 PsiBlast_CBE 87.2736% -91 - C4 -1YC2 6.6 NPD2_ARCFU
28 PsiBlast_CBE 86.4736% -90 - C4 -1S7G - NPD2_ARCFU -
14 PsiBlast_PDB 86.4632% -96 - C4 -4F56 - SIR5_HUMAN -
13 PsiBlast_PDB 86.1632% -99 - C4 -4F4U - SIR5_HUMAN -
31 PsiBlast_CBE 85.8332% -95 - C4 -3RIY 8.0 SIR5_HUMAN
99 Fugue 85.7626% -99 - C4 -5BTR - ? -
9 PsiBlast_PDB 85.7536% -93 - C4 -1YC2 - NPD2_ARCFU -
95 Fugue 85.7133% -94 - C4 -1ICI - NPD1_ARCFU -
15 PsiBlast_PDB 85.4932%-102 - C4 -2NYR - SIR5_HUMAN -
12 PsiBlast_PDB 85.3132% -96 - C4 -3RIY - SIR5_HUMAN -
8 PsiBlast_PDB 85.2436% -94 - C4 -1S7G - NPD2_ARCFU -
18 PsiBlast_PDB 85.2331% -99 - C4 -2B4Y 2.5 SIR5_HUMAN
24 PsiBlast_CBE 85.2236% -93 - C4 -1YC2 - NPD2_ARCFU -
34 PsiBlast_CBE 85.1832% -98 - C4 -4G1C - SIR5_HUMAN -
16 PsiBlast_PDB 84.9532% -95 - C4 -4G1C 9.8 SIR5_HUMAN
6 PsiBlast_PDB 82.5534% -88 - C4 -1M2J 9.4 NPD1_ARCFU
38 PsiBlast_CBE 82.3332% -86 - C4 -4UUA 3.1 SIR5_DANRE
47 PsiBlast_CBE 82.2632% -92 - C4 -4UTX 2.2 SIR5_DANRE
19 PsiBlast_PDB 82.1832% -89 - C4 -4UTR 2.0 SIR5_DANRE
45 PsiBlast_CBE 82.1332% -89 - C4 -4UTZ 3.2 SIR5_DANRE
50 PsiBlast_CBE 82.0632% -84 - C4 -4UTN 3.1 SIR5_DANRE
39 PsiBlast_CBE 82.0032% -90 - C4 -4UUA 4.3 SIR5_DANRE
41 PsiBlast_CBE 81.8732% -91 - C4 -4UU8 3.7 SIR5_DANRE
1 PsiBlast_PDB 81.7834% -88 - C4 -1M2G 9.4 NPD1_ARCFU
46 PsiBlast_CBE 81.7732% -90 - C4 -4UTX 2.8 SIR5_DANRE
37 PsiBlast_CBE 81.6232% -91 - C4 -4UUB 2.7 SIR5_DANRE
35 PsiBlast_CBE 81.3232% -87 - C4 -4HDA 3.4 SIR5_HUMAN
48 PsiBlast_CBE 81.2532% -93 - C4 -4UTV 2.4 SIR5_DANRE
5 PsiBlast_PDB 81.1834% -86 - C4 -1M2H 9.2 NPD1_ARCFU
20 PsiBlast_PDB 81.0732% -92 - C4 -4UTV 3.6 SIR5_DANRE
44 PsiBlast_CBE 81.0332% -91 - C4 -4UTZ 2.0 SIR5_DANRE
4 PsiBlast_PDB 80.6334% -84 - C4 -1M2N 7.0 NPD1_ARCFU
40 PsiBlast_CBE 80.4532% -86 - C4 -4UU8 3.1 SIR5_DANRE
42 PsiBlast_CBE 80.3032% -84 - C4 -4UU7 2.9 SIR5_DANRE
7 PsiBlast_PDB 79.8934% -84 - C4 -1M2K 9.9 NPD1_ARCFU
36 PsiBlast_CBE 79.8432% -91 - C4 -4UUB 3.1 SIR5_DANRE
22 PsiBlast_CBE 79.1334% -83 - C4 -1M2N 7.2 NPD1_ARCFU